Conserved Protein Domain Family
PRK14678

?
PRK14678: PRK14678 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173141
View PSSM: PRK14678
Aligned: 5 rows
Threshold Bit Score: 186.619
Threshold Setting Gi: 148655858
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156741984   1 MTGRRTRLGDWGETMAARFLARRGYEVLARKWRCAAGEIDIVARHDGDLVFVEVRTRRGRDpgmAAESITNAKRARLMAL 80 
148655858   1 MAERRRRLGDWGEAVAVAYLAQHGYQVVAQKWRCAAGEIDIVAQRDGVLAFVEVRTRRGVDpgmAAGSITGAKRARLMML 80 
163848248   1 MPTPKRRLGEVGEQAAAAYLERCGYTIIARNWRCRDGEIDLVAREGDQIVFVEVRTRHDQH---ALETITLAKQQRLVAL 77 
219847851   1 MPTPKRQLGDRGEQVAAVYLERCGYTIIARNWRCRNGEIDMVARDGDYLVFVEVRTRRDEY---ALESLLMHKRQRLVTL 77 
222526158   1 MPTPKRRLGEVGEQAAAAYLERCGYTIIARNWRCRDGEIDLVAREGDQIVFVEVRTRHDQH---ALETITLAKQQRLVAL 77 
156741984  81 ADAFLAAHDLPSNTPWRIDVVAISVgLRAQEVSIEHIPYAVEEA 124
148655858  81 ACLFLAAHDLPADTPWRIDVVAIAV-ASQGRVAIDHILAAVEET 123
163848248  78 AYHYLSAHDLPATTRWRIDVIALTA-RGGRIVDYDHVIAAVGED 120
219847851  78 AYHYLAEHDVPETTPWRIDVIALTV-VGNRLVVTDHVMAAIGEE 120
222526158  78 AYHYLSAHDLPATTRWRIDVIALTA-RGGRIVDYDHVIAAVGED 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap