Conserved Protein Domain Family
PRK14676

?
PRK14676: PRK14676 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173139
View PSSM: PRK14676
Aligned: 5 rows
Threshold Bit Score: 181.682
Threshold Setting Gi: 56695315
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
77462358    1 MSGEVSYYAGQTAEEAVARIYDRSGRPVAARRWRGVSGEIDLIAREGAEVIFIEVKKSTSHAAAAARLSRRQMDRIYGAA 80 
126461235   1 MSGEVSYYAGQTAEEAVARIYDRSGRPVAARRWRGVSGEIDLIAREGAEVIFIEVKKSKSHAAAAARLSRRQMDRIYGAA 80 
146276524   1 MSGEVSHRAGFVAEEAVARIYERADRPVTARRWRGAAGEIDLIARDGAEVIFIEVKKSKSHAAAAARLSRRQMERIYGAA 80 
56695315    6 SRGTRNHLAGEAAENSVLRDYERRGYHLVRRRWRGRCGEIDLIARSGDEVVFVEVKQSRDFARAAESLGARQMKRLHAAA 85 
221638217   1 MSGEVSYHAGQTAEEAVARIYDRSGRPVAARRWRGLSGEIDLIAREGAEVIFIEVKKSTSHAAAAARLSRRQMDRIYGAA 80 
77462358   81 SEFLAGEPRGQLTASRFDVALVDALGRVEIIENAFAA 117
126461235  81 SEFLAGEPRGQLTASRFDVALVDALGRVEIIENAFAA 117
146276524  81 SEFLAGEPLGQLTASRFDVALVDGMGRIEIIENAFAA 117
56695315   86 AEFLAEEPDGQLTPMRFDVALVDGTGRLEIVENAFGH 122
221638217  81 SEFLAGEPRGQLTASRFDVALVDALGRVEIIENAFAA 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap