Conserved Protein Domain Family
PRK14675

?
PRK14675: PRK14675 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173138
View PSSM: PRK14675
Aligned: 6 rows
Threshold Bit Score: 245.515
Threshold Setting Gi: 39995756
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
197119786   1 MPDKSSNSSLGGIGESIAVTFLKGQGFKIVECNFRSVCGEIDIIARDGRALVFVEVKCRKNYNYGVPQLAVTPFKQRQIS 80 
222054592   3 GEGKNDNKTLGEVGEAIAVTFLKGLHFSILERNFRCKCGEIDIIARDGRTLVFVEVKTRKNTAFGVPQLAVTPFKQRQIS 82 
39995756    4 GEGSHHNKILGVRGEDLAAAYLERLRYRIIDRNFRCRGGEVDIVARDGKTLVFVEVKTRRTAGYGVPQLAVTPFKQRQIS 83 
148265776   3 SEDRADNKSLGEQGEAIAVCYLKGRKYAIVERNFRCKCGEVDIIARDGKTIVFVEVKTRRNEACGPPQASVTPFKQRQIS 82 
78224060    1 --MSLHNKSLGSKGESLAVTYLERHRYKILERNFRCRGGEIDIVARDGKTIVFVEVKTRTSGHYGPPQLAVTSFKQRQIS 78 
253702076   1 MPDKSSNSSLGGIGESIAVTFLKGQGFKIVECNFRSVCGEIDIIARDGRVLVFVEVKCRKNYNYGVPQLAVTPFKQRQIS 80 
197119786  81 KAALVWLSKKKLFDAEARFDVVAIVLREHELPVIEHIRNAFELAY 125
222054592  83 KAALTWLAQKKMQDAAARFDVIAILQPDHAVPEIEHIKDAFDLAY 127
39995756   84 KAALAWLTRKGMLDVNARFDVIAITILSPDAPRIEHITNAFELAY 128
148265776  83 KAALTWLAKKMLLDAPARFDVVAILQRDHAVPEIEHIKDAFELAY 127
78224060   79 KAALTWLAKQRQLDACARFDVISITFSGQ-MPQIEHIPNAFELAY 122
253702076  81 KAALVWLSKKKLFDAEARFDVVAIVLREHELPVIEHIRNAFDLAY 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap