Conserved Protein Domain Family
uvrC

?
PRK14672: uvrC 
excinuclease ABC subunit C; Provisional
Statistics
?
PSSM-Id: 173135
View PSSM: PRK14672
Aligned: 2 rows
Threshold Bit Score: 1451.86
Threshold Setting Gi: 15639463
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15639463    1 MRPSESLVETLRIQALSAPSTSGVYLWKDVHGVVIYVGKAKSLRTRLTSYFRCRHDPKTRVLMSRAAALEYLQTQHEYEA 80 
189025703   1 MRPSESLVETLRIQALSAPSTSGVYLWKDVHGVVIYVGKAKSLRTRLTSYFRCRHDPKTRVLMSRAAALEYLQTQHEYEA 80 
15639463   81 LLLENTLIKKHTPRYNICLKDGKTYPLLKLTCEPFPRIFRTRQFCQDGARYFGPFPDVQILDSFLKLILRTYKIRTCTTL 160
189025703  81 LLLENTLIKKHTPRYNICLKDGKTYPLLKLTCEPFPRIFRTRQFCQDGARYFGPFPDVQILDSFLKLILRTYKIRTCTTL 160
15639463  161 RKRKNPCLYYHLKRCDAPCCGWVSPRTYQKDIHEITLLLEGNIDATVARLEKRMKRAVRQEAFEAAARIRDDIQAIRCIT 240
189025703 161 RKRKNPCLYYHLKRCDAPCCGWVSPRTYQKDIHEITLLLEGNIDATVARLEKRMKRAVRQEAFEAAARIRDDIQAIRCIT 240
15639463  241 HKSLVQDMDERARDYIAWSSTGAIVTFAVLRMRGGKLNGRELFRTRSLKNEEEILSEFLITYYSDHTIPPHLFVHSSAGL 320
189025703 241 HKSLVQDMDERARDYIAWSSTGAIVTFAVLRMRGGKLNGRELFRTRSLKNEEEILSEFLITYYSDHTIPPHLFVHSSAGL 320
15639463  321 AEHWLSHKAGTQCTVTLIPLHTFPTPQTPSSTVTTNAPTLAASQNSNAVQDSGLRSCSETSTMHTLQKAHDACTASEGTR 400
189025703 321 AEHWLSHKAGTQCTVTLIPLHTFPTPQTPSSTVTTNAPTLAASQNSNAVQDSGLRSCSETSTMHTLQKAHDACTASEGTR 400
15639463  401 ENTPHESAHTPHHRAILAMAQLNAHEDITRYLKNRGADDALKELQKQLHLARIPTLIEGFDISHLGGKYTVASLICFKNG 480
189025703 401 ENTPHESAHTPHHRAILAMAQLNAHEDITRYLKNRGADDALKELQKQLHLARIPTLIEGFDISHLGGKYTVASLICFKNG 480
15639463  481 APDTKNYRLFNLRAHDTRIDDFASMREAIARRYTHTPEGYTLPDLILVDGGIGHVSAAQHVLDALGLSIPLVGLAKRAEE 560
189025703 481 APDTKNYRLFNLRAHDTRIDDFASMREAIARRYTHTPEGYTLPDLILVDGGIGHVSAAQHVLDALGLSIPLVGLAKRAEE 560
15639463  561 LFIPNSPTPLVLDRRNPALHMLQRIRDEAHRFAITRNRHLRTKKELVLSFERLPHVGKVRAHRLLAHFGSFRSLQSATPQ 640
189025703 561 LFIPNSPTPLVLDRRNPALHMLQRIRDEAHRFAITRNRHLRTKKELVLSFERLPHVGKVRAHRLLAHFGSFRSLQSATPQ 640
15639463  641 DIATAIHIPLTQAHTILHAATRSTTAPVREEYKEHEHDPQGESPGPGRKTD 691
189025703 641 DIATAIHIPLTQAHTILHAATRSTTAPVREEYKEHEHDPQGESPGPGRKTD 691
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap