Conserved Protein Domain Family
uvrC

?
PRK14670: uvrC 
excinuclease ABC subunit C; Provisional
Links
?
Statistics
?
PSSM-Id: 173133
View PSSM: PRK14670
Aligned: 8 rows
Threshold Bit Score: 885.791
Threshold Setting Gi: 51598713
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
111115286   1 MLNENKKILYIGKAKNLRSRIKSYFLEKKSHKIKILMKNVKSIEVITTNSEYEALLLECNLIKTHKPDYNVKLKDGKGYP 80 
119953245  24 MYSQDNKILYIGKAKNLRSRLKNYFLEKISLKTKILMRNVVNIEVITTNSEYEALLLECNLIKEHKPDYNIKLKDDKGYP 103
51598713    1 MLNENKKILYIGKAKNLRSRIKSYFLEKKSHKIKILMKNVKSIEVITTNSEYEALLLECNLIKTHKPDYNVKLKDGKGYP 80 
15594802   24 MLNENKKILYIGKAKNLRSRVKSYFLEKNSHKIKILMKNVKSIEVITTNSEYEALLLECNLIKTHKPDYNVKLKDGKGYP 103
203284366  24 MYSKDNKILYIGKAKNLRSRVKNYFSKRTSHKTKILMNNVTNIEIITTNSEYEALLLECNLIKKYKPTYNIKLKDDKGYP 103
203287900  24 MYSKDNKILYIGKAKNLRSRVKNYFSKRTSHKTKILMNNVTNIEIITTNSEYEALLLECNLIKKYKPTYNIKLKDDKGYP 103
187918322  24 MYSQNNKILYIGKAKNLRARVKNYFLKRISHKTKILMRNVANIEVITTNSEYEALLLECNLIKEYKPDYNIKLKDDKGYP 103
218249718  24 MLNENKKILYIGKAKNLRSRVKSYFLEKNSHKIKILMKNVKSIEVITTNSEYEALLLECNLIKTHKPDYNVKLKDGKGYP 103
111115286  81 MVRITHEKYPRIFKTRKIINDQSEYFGPFTNVKKLDQVLDFINKTFKIRKCKKKSNTPCLYYHMGQCLGVCFKENLEKEY 160
119953245 104 MIRITCEKYPKVFKTRKIINDGSEYFGPYVNAKHLDLVLNLINKTFKTRKCKKKSKNPCLYFHMGQCLGVCYRNDLEEQY 183
51598713   81 MIRITHEKYPRILKTRKIINDQSEYFGPFTNVKKLDQVLDFINKTFKIRKCKKKSNAPCLYYHMGQCLGVCYKENLEKEY 160
15594802  104 MVRITHEKYPRIFKTRKIINDKSEYFGPFTNVKKLDQVLDFINKTFKIRKCKKKSNAPCLYYHMGQCLGVCYKENLEKEY 183
203284366 104 MIRITCEKYPRIFKTRKIINDGSEYFGPYVNVKNLDLVLDLINKTFKTKKCKKKSKNPCLYFHMGQCLGVCYREDLEDEY 183
203287900 104 MIRITCEKYPRIFKTRKIINDGSEYFGPYVNVKNLDLVLDLINKTFKTKKCKKKSKNPCLYFHMGQCLGVCYREDLEDEY 183
187918322 104 MIRITCEKYPRIFKTRKIINDGSEYFGPYVNAKNLDLVLDLINKTFKTRKCKKKSKTPCLYFHMGQCLGVCYREDLEEQY 183
218249718 104 MVRITHEKYPRIFKTRKIINDKSEYFGPFTNVKKLDQVLDFINKTFKIRKCKKKSNAPCLYYHMGQCLGVCYKENLEKEY 183
111115286 161 QEELDKAKSILNGNISEILSQIDIKLKLAVQKEDFENAIKLKEIKSSLIEINQIQIVTKTNNLNTDYVYVHPGENVNTII 240
119953245 184 KEEVNKIRHILNGNISKLLDEIEIKMKEVIKREDFESAIKLKETKRSLIEISQTQIITKINKLSTDYIYIHKTDNLNVIV 263
51598713  161 QIEVNKAKSILNGNISEILSQIDIKLKLAVQKEDFETAIKLKEMKSSLIEINQIQIVTKANNLNIDYVYVHPGENVNTII 240
15594802  184 QKELDKAKSILNGNISEISSQIDIKLKHAIQKEDFETAIKLKEIRNSLIEINQIQIVTKTNNLNIDYVHVHPGENVNTII 263
203284366 184 RKEIEQIKHILNGNISKLLNDIEIKMKEVIMKENFEAAIKLKETKKSLIEISQTQIITKIDKLSEDYLYIHKTNSLNTIV 263
203287900 184 RKEIEQIKHILNGNISKLLNDIEIKMKEVIMKENFEAAIKLKETKKSLIEISQTQIITKIDKLSEDYLYIHKTNSLNTIV 263
187918322 184 KKEVDKIRHILNGKISKLLDETEIKMKEAIKKEDFEAAIKLKETKRSLIEISQTQIITRMNKLSADYIYIHQTDSLNAIV 263
218249718 184 QKELDKAKSILNGNISEISSQIDIKLKHAIQKEDFETAIKLKEIRNSLIEINQIQIVTKTNNLNIDYVHVHPGENVNTII 263
111115286 241 VLKYRNGKLVERDANFDESICKKNELILQFLIQYYTSINMIVPDKIHIFLKdIDTKNAEKLINEIKNTKTEIIYKETEEI 320
119953245 264 IFKYKDGKLVEKDINFDESIYEEEELIAEFITQYYTSLNMIVPDKICIFKK-IETEDITKLINELKSTNTEIVYEETKDA 342
51598713  241 VLKYRDGKLVERDANFDESICKKDELVLQFLIQYYTSINMIVPDKIHIFLKdVDTKNVEKLINEIKNTKTEIIYKETKEI 320
15594802  264 VLKYRNGKLVERDANFDESICKENELILQFLIQYYTSINMIVPDKIHIFLKdIDTKNVEKLINEIKNTKTEIIYKETEEI 343
203284366 264 ILKYKDGKLTEKDIHFDESIYEEDELIEKFITQYYTSPNMIVPDKIHIFKK-IDTSNITKLINELKNIKTEIIYKETQDN 342
203287900 264 ILKYKDGKLTEKDIHFDESIYEEDELIEKFITQYYTSPNMIVPDKIHIFKK-IDTSNITKLINELKNIKTEIIYKETKDN 342
187918322 264 ILKYKDGKLVEKDINFDESIYEEDELTAKFITQYYTALNMIVPNKIYIFKK-IETENITKLINELKNTKTEIICEETKET 342
218249718 264 VLKYRNGKLVERDANFDESICKENELILQFLIQYYTSINMIVPDKIHIFLKdIDTKNVEKLINEIKNTKTEIIYKETEEI 343
111115286 321 LKIMEMAISNAELSLREYENKNNKALESLKIFLEMDKLPKIIEGFDIAHLKGQETVASMVTFKMGIPFKENYKLYKLNSL 400
119953245 343 IKIMEMAISNAEIALKAYNNEKNKALENLKIILEMTKLPKTIEGFDIAHLNGYKTVASLVTFKMGKPFKDGYRVYKINSL 422
51598713  321 LKIMEMAISNAKLSLREYENKSNKALESLKIFLEMDKLPKIIEGFDIAHLKGQETVASMVTFKMGIPFKENYKLYKLNSL 400
15594802  344 LKIMEMAISNAELSLREYENKSTKALESLKIVLEMDKLPKIIEGFDIAHLKGQETVASMVTFKMGMPFKENYRLYKLNSL 423
203284366 343 IKIIEMATSNAKLALITYNHEKNKAIENLKTILEMKKLPKTIEGFDIAHINGYKTVASLVTFKMGKPFKDGYRVYKINSL 422
203287900 343 IKIIEMATSNAKLALITYNHEKNKAIENLKTILEMKKLPKTIEGFDIAHINGYKTVASLVTFKMGKPFKDGYRVYKINSL 422
187918322 343 IKIMEMAISNAKIALREYDNEKNRALESLKNILEMTKLPKTIEGFDISHLNGHKTVASLVSFKMGKPFKDGYRVYKINSL 422
218249718 344 LKIMEMAISNAELSLREYENKSTKALESLKIVLEMDKLPKIIEGFDIAHLKGQETVASMVTFKMGMPFKENYRLYKLNSL 423
111115286 401 LKGEIDDVKAIKEVILRRYSEIINKNLELPNLILIDGGKGQLNAAFSILKGLKIENKVKVCSLAKKHETIFLTTNKKGIN 480
119953245 423 NDGEINDFKAIKEIISRRYTKLINEQLELPTLILIDGGKGQLNAAYSILKGLKIEDKVTICALAKQEETIFLPNKTQGIK 502
51598713  401 LKGEIDDFRAIKEAILRRYSEIINKKLELPNLILIDGGKGQLSAAFSILKSLKIEDKVKVCSLAKKHETIFLITNKKGIN 480
15594802  424 LKGEIDDFKAIKEVISRRYSEIINNNLELPNLILIDGGKGQLNAALSILKGLKIENKVKVCSLAKKQETIFLTTNKKGIN 503
203284366 423 SNGEIDDCKAIKEVISRRYSKLINEQLKLPDLILIDGGKGQLNAAYSILKGLRIEEKIAICALAKKEEIIFLPNKNQGIK 502
203287900 423 SNGEIDDCKAIKEVISRRYSKLINEQLKLPDLILIDGGKGQLNSAYSILKGLRIEEKIAICALAKKEEIIFLPNKNQGIK 502
187918322 423 NNGEIDDLKAIKEVISRRYSKLINEQLALPDLILIDGGKGQLSAAYSILKGLKIENEVIVCALAKKEEIIFLPNKTQGIK 502
218249718 424 LKGEIDDFKAIKEVISRRYSEIINNNLELPNLILIDGGKGQLNAALSILKGLKIENKVKVCSLAKKQETIFLTTNKKGIN 503
111115286 481 LPQGHPALRILQNVRDEAHRKANGFNKKRREKITLLYTKINGIGEKTAQKILKSIGTYKDILPLSENEISEKIKVNIRLA 560
119953245 503 LPKGNPALKILQNVRDESHRKANSFNRKLRKNIKLNYSKIEGIGEKKAKNILKTLGTYKDIFLLNEDEIAQKMKINIKMA 582
51598713  481 LPQGHPALRILQNVRDEAHRKANGFNKKRREKITLLYKKIDGVGEKTAQKILKLIGTYKDILPLSENEISEKIKVNIKLA 560
15594802  504 LPQGHPALRILQNVRDEAHRKANGFNKKRREKITLLYTKIHGIGEKTAQKILKSIGTYKDILPLSENEISEKIKVNVQLA 583
203284366 503 LQKRNSALQVLQNVRDEAHRRANNFNNKLHNNIKLNYTKIKGIGEQKAKKILKVLGTYKDILLLNEDEIATKMKINITMA 582
203287900 503 LQKRNSALQVLQNVRDEAHRRANNFNNKLHNNIKLNYTKIKGIGEQKAKKILKVLGTYKDILLLNEDEIATKMKINITMA 582
187918322 503 LSKGNPALQILQNVRDEAHRRANSFNRTLRRNIKLNYSKIKGIGEEKAKNILKTLGTYKDILLLNEDEIAKKMKINIKMA 582
218249718 504 LPQGHPALRILQNVRDEAHRKANGFNKKRREKITLLYTKIHGIGEKTAQKILKSIGTYKDILPLSENEISEKIKVNVQLA 583
111115286 561 KRIKEFAIKENSIKT 575
119953245 583 KKIKKFSEDQNLKNT 597
51598713  561 KRIKEFAIKENSIKN 575
15594802  584 KRIKEFAIKENSIKN 598
203284366 583 NKIKKFAEEQNLNNK 597
203287900 583 NKIKKFAEEQNLNNK 597
187918322 583 KKIKKFSEDQNLKNT 597
218249718 584 KRIKEFAIKENSIKN 598
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap