Conserved Protein Domain Family
mnmA

?
PRK14665: mnmA 
tRNA-specific 2-thiouridylase MnmA; Provisional
Statistics
?
PSSM-Id: 173128
View PSSM: PRK14665
Aligned: 4 rows
Threshold Bit Score: 742.52
Threshold Setting Gi: 150003570
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29348763    1 MMEENKRVLLGMSGGTDSSVAAMRLLEAGYEVTGVTFRFYELNDSTEYLEDARHLAERLGIRHITYDAREIFRKQIIEYF 80 
60679769    1 MMEKNKRVLLGMSGGTDSSVAAMLLLEAGYEVTGVTFRFYEFNGSTEYLEDARALAARLGIGHITYDARKVFQEQIIDYF 80 
53711506    1 MMEKNKRVLLGMSGGTDSSVAAMLLLEAGYEVTGVTFRFYEFNGSTEYLEDARALAARLGIGHITYDARKVFQEQIIDYF 80 
150003570   3 ETESNNKVLLGMSGGTDSSVAALLLQDAGYEVTGITFRFYEKENDTEYLEDARALCERLNIPHLTYDVRDTFRKTIIDYF 82 
29348763   81 VHEYMVGHTPVPCTLCNNYLKWPLLSKIADEMGIFYIATGHYVRKVKVDDTCYITYAADSDKDQTFFLWGLKQDILRRML 160
60679769   81 IDEYMSGHTPVPCTLCNNQLKWPLLAKIADEMGIFYLATGHYVRKQWIDGNYYIAPAEDVDKDQSFFLWGLRQEILQRML 160
53711506   81 IDEYMSGHTPVPCTLCNNQLKWPLLAKIADEMGIFYLATGHYVRKQWVDGNYYIAPAEDVDKDQSFFLWGLRQEILQRML 160
150003570  83 INEYMAGHTPVPCTLCNNYLKWPLLKKISDEMGIYHFATGHYVRRRFINGCYHITTGVDPDKDQSFFLWGLPQEILQRML 162
29348763  161 LPMGDITKVEARAFAAERGFQKVAVKRDSLGVCFCPMDYRSFLKMWLVSNCQPQvsvgqpqvsaGQTWSAEVRRGRFVDE 240
60679769  161 LPMGGMTKSEARAYAAGRGFEKVSKKKDSIGVCFCPLDYRSFLKKCLCDESGDK----------NRNIYRKVERGRFLDE 230
53711506  161 LPMGGMTKSEARAYAAGRGFEKVSKKKDSIGVCFCPLDYRSFLKKCLCDESGDK----------NRNIYRKVERGRFLDE 230
150003570 163 LPMGNLTKARVREIAAERGFLKAAHKRDSLGVCFCPMDYRTFLHKELPEGS--------------------ILPGKFFDE 222
29348763  241 KGDFIAWHEGYPFYTVGQRRGLGIHLNRAVFVKEIRPEKNEVVLASLQALEKTEMLLKDWNIVNRERLLGHADIIVKIRY 320
60679769  231 SGNFIAWHEGYPFYTIGQRRGLGIQLNRAVFVKEIHPETNEVVLASLKSLEKSEMWLKDWNIVDESRLLGCDDVIVKIRY 310
53711506  231 SGNFIAWHEGYPFYTIGQRRGLGIQLNRAVFVKEIHPETNEVVLASLKSLEKSEMWLKDWNIVDESRLLGCDDVIVKIRY 310
150003570 223 MGNFIARHKGYPFYTIGQRRGLGIDLNRAVFVKEIIPAENKVILSDLKALEKTEMRLKEWHITNPALLLNKDDIIVKIRY 302
29348763  321 RKQENHCTVTVTLDNFLHVQLHEPLTAIASGQAAAFYKDGLLLGGGIIVE 370
60679769  311 RKQENHCSVTITPEGLLHIRLHEPLSAIAEGQAAAFYKDGLLLGGGIITM 360
53711506  311 RKQENHCSVTITPEGLLHIRLHEPLSAIAEGQAAAFYKDGLLLGGGIITM 360
150003570 303 RKQANRCTVTLQPDNTLHVQLHEPLTAIAPGQAAAFYRDDVVLGGGIII- 351
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap