Conserved Protein Domain Family
PRK14664

?
PRK14664: PRK14664 
tRNA-specific 2-thiouridylase MnmA; Provisional
Statistics
?
PSSM-Id: 173127
View PSSM: PRK14664
Aligned: 4 rows
Threshold Bit Score: 749.86
Threshold Setting Gi: 150003843
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150003843   1 MNNRDKRVLVGMSGGIDSSATCIMLQEQGYEVVGVTMRTWDvpsrfstpgqDEPDDvleARALAERLGIEHHVADVRKEF 80 
53715285    1 MKESKKRVLVGMSGGIDSTATCLMLQEQGYEIVGVTMRVWG----------DEPQD---ARELAARMGIEHYVADERVPF 67 
60683221    1 MKESKKRVLVGMSGGIDSTATCLMLQEQGYEIVGVTMRVWG----------DEPQD---ARELAARMGIEHYVADERVPF 67 
29349296    1 -----------MSGGIDSTATCLMLQEQGYEIVGVTMRVWG----------DEPQD---ARELAARMGIEHYVADERIPF 56 
150003843  81 KQIIVKHFIDEYMQGRTPNPCVLCNPLFKERILCEWADQTNCAHISTGHYCRLEERKGKLYIVAGDDQTKDQSYFLWKLP 160
53715285   68 KDTIVKNFIDEYRQGRTPNPCVMCNPLFKFRMLIEWADKLGCDWIATGHYSRLEERNGHIYIVAGDDDKKDQSYFLWRLG 147
60683221   68 KDTIVKNFIDEYRQGRTPNPCVMCNPLFKFRMLIEWADKLGCDWIATGHYSRLEERNGHIYIVAGDDDKKDQSYFLWRLG 147
29349296   57 KETIVKNFIDEYKQGRTPNPCVMCNPLFKFRVLAEWADKLDCAYIATGHYSRLEERSGHIYIVAGDDDKKDQSYFLWRLG 136
150003843 161 QEILQRFLFPLGTYTKQEVREYLRQKGFEAKARGGESMEICFIEGDYRNFLRSQCPDIDTQVGPGWFVNSKGVKIGQHKG 240
53715285  148 QDVLRRCIFPLGNYTKQTVRDYLHEKGYEAKSKEGESMEVCFIKGDYRDFLREQCPELDAEVGPGWFVSSEGVKLGQHKG 227
60683221  148 QDVLRRCIFPLGNYTKQTVRDYLREKGYEAKSKEGESMEVCFIKGDYRDFLREQCPELDAEVGPGWFVSSEGVKLGQHKG 227
29349296  137 QDILKRCIFPLGDYTKIKVREYLAEKGYEAKSKEGESMEVCFIQGDYRDFLREQCPELDTEIGPGWFVNSEGVKLGQHKG 216
150003843 241 FPYYTIGQRKGLEIALGHPAYVLRINAEKNTVMLGDAEELKAEYMLVEDYHITEMQDLLQCKDLSVRIRYRSKPIPCQVL 320
53715285  228 FPYYTIGQRKGLEIALGKPAYVLKINPQKNTVMLGDAGQLKAEYMVAEQDNIVDEDELFACPDLAVRIRYRSRPIPCRVK 307
60683221  228 FPYYTIGQRKGLEIALGKPAYVLKINPQKNTVMLGDAGQLRAEYMVAEQDNIVDEDELFACPDLAVRIRYRSRPIPCRVK 307
29349296  217 APYYTIGQRKGLEIALGKPAYVLKINPQKNTVMLGDAEQLQTEYMLAEQDRIVDEQELFSCENLAVRIRYRSRPIPCRVK 296
150003843 321 VLDEKQLLVRFLSEASAIAPGQSAVFYEGKRVLGGAFIASQRGIRKIAADNQDKF 375
53715285  308 RLEDGHLLVRFLAEASAIAPGQSAVFYEGRRVLGGAFIASQRGIGLVIEQNKDWK 362
60683221  308 RLEDGRLLVRFLAEASAIAPGQSAVFYEGRRVLGGAFIASQRGIGLVIEQNKDWK 362
29349296  297 RLEDGRLLVRFRETASAVAPGQSAVFYDGRRVLGGAFIASQRGIGLVIIENKDKL 351
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap