Conserved Protein Domain Family
acpS

?
PRK14660: acpS 
holo-[acyl-carrier-protein] synthase
Links
?
Statistics
?
PSSM-Id: 173123
View PSSM: PRK14660
Aligned: 3 rows
Threshold Bit Score: 166.206
Threshold Setting Gi: 51894074
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
94971544    1 MILGTGIDIVEVPRIAQSIQRFGDRFLGRIYTPAEIRYCQ-SKANAVERFAARFAAKEAAMKAIGTGMRGGVTWHDFEVG 79 
116625762   1 MIVGTGVDLAEVDRIQRSIERYGDKFIKRIYTPGEIAYVE-RKANKFERYAARFAAKEAGMKAIGTGWRHGVRWQDFEVA 79 
51894074    1 MILGTGVDIVAVERVARAVERHGDRFLRRVFTPGELAYCTsSEAHRAARLAARFAAKEAVLKALGIGLRE-VRWTDAEVC 79 
94971544   80 REPGGRPTMVFHGKAAQVAQGLGGRRAHLSVSHTEQYAVASVILED 125
116625762  80 NLRTGKPTLLLHGVAARYAEKLGVKNIALSITHTAALGMAHVILEN 125
51894074   80 RDERGRPSVRLTGRLAEIAAARGATRIHLSLSHTQEYAVAQVVIEG 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap