Conserved Protein Domain Family
acpS

?
PRK14658: acpS 
holo-ACP synthase
Links
?
Statistics
?
PSSM-Id: 173121
View PSSM: PRK14658
Aligned: 3 rows
Threshold Bit Score: 157.486
Threshold Setting Gi: 170762431
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
209554166   1 MKLVHGIDIIEWNREELNNPSFAKRILVDDELKYYLQLNSLKEKNRYLASIFASKEAVMKAFKLKYGYNDILILKTKNER 80 
170762431   1 MKLVHGIDIIEWNREELNNPLFAKRILIDNELEYYFQLNSSREKKRYLASVFACKEAVMKALKLKYGYGDILILKTENQR 80 
13357954    1 MKLVHGIDIIEWNREELNNPLFAKRILIDNELEYYFQLNSSREKKRYLASVFACKEAVMKALKLKYGYGDILILKTENQR 80 
209554166  81 QVYLNKILIKELVLSISYTENYVVASVVGLINTVE 115
170762431  81 QVYLNKILIKELELSISYTETYIVASVVGLINNMN 115
13357954   81 QVYLNKILIKELELSISYTETYIVASVVGLINNMN 115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap