Conserved Protein Domain Family
acpS

?
PRK14657: acpS 
holo-[acyl-carrier-protein] synthase
Statistics
?
PSSM-Id: 173120
View PSSM: PRK14657
Aligned: 7 rows
Threshold Bit Score: 172.265
Threshold Setting Gi: 218885384
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
46580318    1 MIVGIGIDITEIDRIAKGWGRFGDRFARRILHPHEVVRMPAAnPVAFLAGRFAVKEAAVKALGTGFSGGIGPRDIEVGVA 80 
120602301   1 MIVGIGIDITEIDRIAKGWGRFGDRFARRILHPHEVVRMPAAnPVAFLAGRFAVKEAAVKALGTGFSDGIGPRDIEVGVA 80 
78357087    1 MILGTGLDLTELGRIRAALERQPERFPRRILHDSELAAMPRL-SVAWLAARFAAKEAAAKALGTGFTGGVAFRDIEVYKE 79 
220904414   1 MIVGLGVDIVELARIEKSLTRFGRRFAEKVLSPEEMAAMPTL-TVNYIAGRFAVKEAAVKALGTGFSQGIGPTLVETVAT 79 
218885384   1 MIVGLGIDIAELSRIARAWERHGRRFAARVLHPAELACLPAA-PVAFLAARFAAKEAAVKALGTGFSQGIGPRDIEVRPL 79 
239907391   1 MIRGLGIDVVELDRIEAALIRFGDRFLARILTPAERAALPPI-PLTRTAGLFAAKEAAAKALGTGFAQGVAFHTLEILSD 79 
242279463   1 MIIGLGIDITELDRIKRSLDKYGERFAEKILTPAEIELIPAKnPVPYVAARFAAKEAAVKALGTGFAEGITFHTIEITRL 80 
46580318   81 PAGAPQLVLHGKAAARMEALGATRTHVSLTHGRDTAAAVVILES 124
120602301  81 PAGAPQLVLHGKAAARMEALGATRTHVSLTHGRDTAAAVVILES 124
78357087   80 LSGKPCLRFHGAAFEHAQKMGVKKIHLSLTHGRDTAAAVVILEG 123
220904414  80 SGGKPQLRLHGAALQCARDLGVTSCHVSISHDRSSAVAVVVLEA 123
218885384  80 PTGQPQLVLHGKAAARCAALGATATHVSLTHGRDTAAAVVVLER 123
239907391  80 AAGRPALTLHGPALARAEALGATSWHVSISHSRDTAAAVVVLEG 123
242279463  81 DSGAPQLNFLGKALERSKSMGVEGIHISITHGRDTAAAVVVLEK 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap