Conserved Protein Domain Family
mraY

?
PRK14655: mraY 
phospho-N-acetylmuramoyl-pentapeptide-transferase; Provisional
Statistics
?
PSSM-Id: 173118
View PSSM: PRK14655
Aligned: 3 rows
Threshold Bit Score: 502.916
Threshold Setting Gi: 15806835
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
94985561    1 MVIAALLSWFLVGLFIRVSKARGWGQPVRQDGPQTHLKKEGTPTAGGVAFVLALALVFFPLYVTGHAGG---ERELLIML 77 
15806835    2 MVVAALLSWFLLGLFIHYSKKFGWGQPIRQDGPQTHLAKEGTPTAGGVAFVLALLLVFVGLLAFGGIGQanlSREVMILL 81 
226356435   2 LMVAALLSWFLVGLFIRASKARGWGQPVRKDGPQTHLVKEGTPTAGGVAFVLAMALVFFPLYLSGHAGG---ERELLIML 78 
94985561   78 AALAMGIIGGLDDLLKIRARMRGkGKKELLAREKFPLQFLVGLVFAYFAAPLASHELLPSLG-----RVPDVILLTLVMV 152
15806835   82 AALGMGVVGGIDDFLKIRSRKFG-GKKELLAREKFPLQVLVALLFAGFAAPLASHQLLPGFMsiggyPIFDMLFIAFVMV 160
226356435  79 TALAMGVVGGVDDWLKIQSRMRGhGKKELLAREKFPLQFLVALVFAWLAAPLASHELVPSLG-----PVMDVVLIALVMV 153
94985561  153 GAVNAFNFTDGLDGLLAGVAMIVLLPLLAVSPVSALLVAVLLGFLWFNAHPARVFMGDMGSHAIGAVAAGVYILYADVWL 232
15806835  161 GSVNAFNFTDGLDGLLAGVGMIVLLPLVAVSPIAALMVAVLLGFLWFNAHPARVFMGDMGSHAIGAVAAGAYALYSDVWL 240
226356435 154 GSVNAFNFTDGLDGLLGGVAIIVLLPLLALSPVSALLVAVLLGFLWFNAHPARVFMGDMGSHAIGAVAAGAYILYADVWL 233
94985561  233 LPLAAIIPVVAVLSVIIQVVSFRLRGKRVFRMSPIQHHFELSGWPETHVTARFWVVTAAATAAVWWVLGGRP 304
15806835  241 LPIAAIIPVAAVLSVVIQVASVRLRKRKVFKMSPIQHHFELSGWPETHVTLRFWVVTGIATALTWWLMGGRP 312
226356435 234 LPIAAIIPVVAVLSVMIQVISFKTRGKRIFRMSPIQHHFELSGWPETHVTIRFWVITAVATAAVWWLLGARP 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap