Conserved Protein Domain Family
mraY

?
PRK14654: mraY 
phospho-N-acetylmuramoyl-pentapeptide-transferase; Provisional
Links
?
Statistics
?
PSSM-Id: 173117
View PSSM: PRK14654
Aligned: 5 rows
Threshold Bit Score: 487.865
Threshold Setting Gi: 281412292
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
170288511   1 MIAANFLLNLFLYPILIKLFRRRRIGQYIRKEGPDLHGYKEGTPTMGGILFVLTGFLFGMISKTTTMVLLGMFLFFLIGF 80 
222099425   1 MIAASFLLNLLIYPFLINLFRKKSVGQYIRKEGPDLHGYKEGTPTMGGILFVLIGLLFGVLSKENGVILTGAFLFFLIGF 80 
148269825   1 MIAANFLLNLFLYPILIKLFRRRRIGQYIRKEGPDLHGYKEGTPTMGGILFVLTGFLFGMISKTTTMVLLGMFLFFLIGF 80 
15643007    1 MIAANFLLNLFLYPILIKLFRRRRIGQYIRKEGPDLHGYKEGTPTMGGILFVLTGFLFGMISKTNTMVLLGMFLFFLIGF 80 
281412292   1 MIAANFLLNLVLYPILIKLFRHRRIGQYIRKEGPDLHGYKEGTPTMGGILFVLTSFLFGMISKTNTIVLLGMFLFFLIGF 80 
170288511  81 LDDFLSVVRKDSTGLKTYQKALLQTLSALIMLLLIRPETNVDFFGFTIEMGKWYYLFALLVIVGSSNAMNLTDGLDGLAG 160
222099425  81 LDDFLSIAKKNSTGLRAYQKALLQIAAASVVIAFSQPETAVDFFGIKLEMGAWYYLLALIVIVGSSNAMNLTDGLDGLAG 160
148269825  81 LDDFLSVVRKDSTGLKTYQKALLQTLSALIMLLLIRPETNVDFFGFTIEMGKWYYLFALLVIVGSSNAMNLTDGLDGLAG 160
15643007   81 LDDFLSVARKDSTGLKTYQKALLQTLAAFIMLLLIRPDTNVDFFGSTIEMGKWYYLFALLVIVGSSNAMNLTDGLDGLAG 160
281412292  81 LDDFLSVARKDSTGLKTYQKALLQTLVAFIMLLLIRPETNVDFFGFTIEMGKWYYLFALLVIVGSSNAMNLTDGLDGLAG 160
170288511 161 WIYVSGSIPYWFFLKERGVSEDILLILGAGVLAFLVFNSKPAKIFMGDTGSITLGGVLGTVSVLTKTEFYLVLFFLIPVI 240
222099425 161 WVYISGAIPYWFFLKEKGFSENIIILLSAGVLAFLIFNSKPARIFMGDTGSIALGGTLGVVSVLTKTEFYLIVFFPILVV 240
148269825 161 WIYVSGSIPYWFFLKERGVSEDILLILGAGVLAFLVFNSKPAKIFMGDTGSITLGGVLGTVSVLTKTEFYLVLFFLIPVI 240
15643007  161 WIYVSGSIPYWFFLKERGVSEDILLILGVGVLAFLVFNSKPAKIFMGDTGSITLGGVLGTVSVLTKTEFYLVLFFMIPVI 240
281412292 161 WIYVSGSIPYWFFLKERGVSEDILLILGAGVLAFLVFNSKPAKIFMGDTGSITLGGVLGTVSVLTKTEFYLVLFFLIPVI 240
170288511 241 ETLSVILQVGSFKIFKRRIFRMSPLHHHFELIGWSEEKIVAVFTVFNLVSSLVVLEIFGVIA 302
222099425 241 ETLSVILQILSFKLFKRRIFRMAPLHHHFELLSWEEEKIVAVFTIFNLISSLIALEVFGVIG 302
148269825 241 ETLSVILQVGSFKIFKRRIFRMSPLHHHFELIGWSEEKIVAVFTVFNLISSLVVLEIFGVIA 302
15643007  241 ETLSVILQVGSFKIFKRRIFKMSPLHHHFELIGWSEEKIVAVFTVFNLISSLVALEIFGVIG 302
281412292 241 ETLSVILQVGSFKIFKRRIFRMSPLHHHFELIGWSEEKIVAVFTVFNLISSLVVLEIFGVIA 302
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap