Conserved Protein Domain Family
PRK14650

?
PRK14650: PRK14650 
UDP-N-acetylmuramate dehydrogenase
Statistics
?
PSSM-Id: 173113
View PSSM: PRK14650
Aligned: 8 rows
Threshold Bit Score: 497.83
Threshold Setting Gi: 203284502
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218249837   1 MPKSLNNFLKKINIKPQTKNLADYTTYKIGNISKLFLTPKNIKEAENIFKAAIEEKIKLFILGGGSNILVNDEREIDFPI 80 
203288036  13 MLENINNFLKKINIQPQTTNLANYTTYKIGGISKLFLIPKTIEDTKHIFKTAIQEKIKIFILGGGSNILINDEEEINFPI 92 
203284502  13 MLENINNFLKKINIQPQTTNLANYTTYKIGGISKLFLIPKTIEDAKHIFKTAIQEKIKIFILGGGSNILINDEEEINFPI 92 
187918459   1 MSKNINNFLKKINIKPKTKNLANYTTYKIGGISKLFLTPKTIKDTEHIFKVAIEEKIKIFILGGGSNLLINDGGEIDFPI 80 
119953382   1 MLKNINNFLEKINIKPKTENLANHTTYKIGGISKLFLTPKTIKDAEHIFKVAIKEKVKIFILGGGSNLLINDEVEIDFPI 80 
111115427   1 MLKSLNNFFKKINIKPQTKNLIDYTTYKIGNISKLFLIPKNIQEAESIFKAAIEEKIKLFILGGGSNILVNDEKELDFPI 80 
15594943    1 MPKSLNNFLKKINIKPQTKNLANYTTYKIGNISKLFLTPKNIKEAENIFKAAIEEKIKLFILGGGSNILVNDEREIDFPI 80 
51598851    1 MIKRLNNFFEKINIKPQTKNLINYTTYKIGNISKLFLIPKNIQEAENIFKAAIEEKITLFILGGGSNILVNDKEELDFPI 80 
218249837  81 IYTGHLNKIEIHENKIVGECGADFESLCKIALNNSLSGLEFIYGLPGTLGGAVWMNARCFGNEISEILKKITFIDDKGKT 160
203288036  93 IYTKHLNKIEIHDNQITAECGTNFNDLCNFALKNELSGLEFIYGLPGTLGGAIWMNARCFGSEISDILDKIIFIDENGNF 172
203284502  93 IYTKHLNKIEIHDNQITAECGTNFNDLCNFALKNELSGLEFIYGLPGTLGGAIWMNARCFGSEISDILDKIIFIDENGNF 172
187918459  81 IYTGHLNKIELQDNQIIAECGTNFDDLCNFALQNELSGLEFIYGLPGTLGGAIWMNARCFGNEISEILDQVVFIDEHGKT 160
119953382  81 IYTGHLNKIELQNNQITAECGTNFDDLCHFALQNELSGLEFIYGLPGTLGGAIWMNARCFGSEISEILDRVIFVDENGQT 160
111115427  81 IYTGYLNRIEIHKNKIVAECGANFENLCKIALDNSLSGLEFIYGLPGTLGGAVWMNARCFGNEISEILKKITFINDKGKT 160
15594943   81 IYTGYLNKIEIHENKIVGECGADFESLCKIALDNSLSGLEFIYGLPGTLGGAVWMNARCFGNEISEILKKITFIDDKGKT 160
51598851   81 IYTGHLNKIEVHDNKIVAECGANFENLCKIALNSSLSGLEFIYGLPGTLGGAVWMNARCFGNEISEILKKITFINDKGKT 160
218249837 161 ICKEFKKEDFKYKISPFQNKNFFILKIELNLKKDNKKIIEEKMNKNKQARINRGHYLFPSSGSTFKNNKAFLKPSGQIIE 240
203288036 173 ICKKFNKNEFAYKISPFQNKNTAILKATLNLKKGNKKHIEKIMKQNKQIRINKGHYLFPSSGSTFKNNKNFLKPTGQIIE 252
203284502 173 ICKKFNKNEFAYKISPFQNKNTAILKATLNLKKGNKKHIEKIMKQNKQIRINKGHYLFPSSGSTFKNNKNFLKPTGQIIE 252
187918459 161 ICKKFERGEFSYKISPFQNKNTVILKATLNLAKGNKKHIEEIMKQNKQNRIDKGHYLFPSSGSTFKNNRKFSKPTGQIIE 240
119953382 161 ICKKLEKSEFSYKISPFQNKNTVILKATLNLTKGNKKHIEEIMKQNKQKRIDKGHYLSPSSGSTFKNNKKFLKPTGQIIE 240
111115427 161 ICKEFKKEDFNYKVSPFQNKNSLILKVELNLKKENKKNIEEKMNKNKQIRINKGHYLFPSSGSTFKNNKAFLKPSGQIIE 240
15594943  161 ICKEFKKEDFKYKISPFQNKNFFILKIELNLKKDNKKIIEEKMNKNKQARINRGHYLFPSGGSTFKNNKAFLKPSGQIIE 240
51598851  161 ICKEFKKEDFKYKVSPFQNKNFFILKTELNLKKENKKIIEEKMNKNKQARINKGHYLFPSSGSTFKNNKSFLRPSGQIIE 240
218249837 241 ECKLKGLSIGGATVSKYHGNFIININNATSKDIKSLIEKVKAEVYLKTGLLLEEEVLYIGFK 302
203288036 253 ECNLKGLQIGGAKVSHYHGNFIINNNNATSREVKTLIDKIKTQVQIKTGFLLEEEILYIGFN 314
203284502 253 ECNLKGLQIGGAKVSHYHGNFIINNNKATSREVKTLIDKIKTQVQIKTGFLLEEEILYIGFN 314
187918459 241 ECHLKGLKIGGAAVSHYHGNFIINNDNASSKDIKTLIERVKTEVQIKTGFLLEEEVLYIGFN 302
119953382 241 ECNLKGLNIGGATVSHYHGNFIINKNNASSKEIKTLIEKVKTEVQIKTGFLLEEEVIYIGFN 302
111115427 241 ECKLKGLSIGGASVSQYHGNFIININHATSNDVKSLIEKVKTEVHFKTGLLLEEEVLYIGFK 302
15594943  241 ECKLKGLSIGGATVSKYHGNFIININNATSKDIKSLIEKVKAEVYLKTGLLLEEEVLYIGFK 302
51598851  241 ECKLKGLSVGGAEVSKYHGNFIININNATSNDIKSLIEKVKTEVYSKTGLLLEEEVLYIGFK 302
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap