Conserved Protein Domain Family
PRK14649

?
PRK14649: PRK14649 
UDP-N-acetylmuramate dehydrogenase
Statistics
?
PSSM-Id: 173112
View PSSM: PRK14649
Aligned: 6 rows
Threshold Bit Score: 526.716
Threshold Setting Gi: 163846335
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148657889   1 MRYLENEPLAPYTSWRIGGPARYFVQATGAADLASALAWAEQRNLPVFILGGGSNILVRDSGFDGLVIRVRGHEVRLEAN 80 
156741079   1 MQYLEYEPLAPYTSWRIGGPTRYFVQVASVAEMIQALTWAHQRDLPIFVLGGGSNVLIRDTGFNGLVMRVRAHDMRLEIN 80 
163846335   7 VTLYPDEPMARHSSWRAGGTARYYAEPATPDEAIALAAWAREQQLPLIWIGRGTNLLVRDEGFDGVIASYRGQRWELIEH 86 
159900024   2 IDLREHELLAPYTAWRIGGPARYFVNVTSPEQQVEAVQWAELRQLPIFMLGGGSNLLMSDAGWNGLVIRNRATGFELHEH 81 
219849720   7 ITLRPNEPMSRHTSWRVGGPAQYYAEPTTPDEAMVLAAWAMTHRLPLIWVGRGTNLLVRDEGFAGVIASYRGQRWALHEH 86 
222524100   7 VTLYPDEPMARHSSWRAGGTARYYAEPATPDEAIALAAWAREQQLPLIWIGRGTNLLVRDEGFDGVIASYRGQRWELIEH 86 
148657889  81 GDTASVIVEAGAPMAGTARRLARQGWSGLEWAEGLPGTIGGALYGNAGCYGSDIATSLDRAWVLVRG-ETQEWSVDRFAF 159
156741079  81 GDEARAIVEAGAPMAGTARRLARQGWAGLEWAEGLPGTIGGALYGNAGCYGSDIATVLERAWVLVDG-EPQEWPTERFVY 159
163846335  87 GETAEVWIEAGAPMAGTARRLAAMGWAGLEWAEGLPGAVGGAIVGNAGCYGGSVAEVLITADLLLNGsECVEWSVHDLAY 166
159900024  82 GDQLTIHVQAGAPTAGTVRRLAAQGIAGLEWAEGLPGTIGGAIYGNAGCYGGETVKHLQSARLLMPDnQIVEWAAADFQF 161
219849720  87 GETAELWVEAGTPMAGTARRLAAMGWAGLEWAEGLPGAIGGAIVGNAGCYGGDTASVLIDAELLLNGsERVVWPVTELGY 166
222524100  87 GETAEVWIEAGAPMAGTARRLAAMGWAGLEWAEGLPGAVGGAIVGNAGCYGGSVAEVLITADLLLNGsECVEWSVHDLAY 166
148657889 160 GYRTSVLKQMRAAGIRWQdQPIVLAAAFRLHRDDLTALAQRMERTSNERRSKTPWGASCGSVFKNPPGDSAGRLIEAAGL 239
156741079 160 GYRTSVLKQIRTDSMAWRdQPIILAAAFRLRRDDLTALAQRMERTSLERRSKTPWGASCGSVFKNPPTESAGRLIEAAGL 239
163846335 167 TYRESVLKQLLHTGI----PPLVLAGRFRLQRGDPAALTARMKAIAAERKQKTPAGSSCGSVFKNPAGDFAGRLIEAAGL 242
159900024 162 DYRTSQLKRLAGNRPTTR-IPYVLDAVLTAWRDDPVWIASKMAEIAEGRKQRTPAGSSCGSVFKNPANTTAGRLIDAAGL 240
219849720 167 AYRESILKRPGADGV----PPLVLAGRFRLHRADPKVLMARIGAIAAERKRKTPAGSSCGSVFKNPPGDSAGRLIEAAGL 242
222524100 167 TYRESVLKQLLHTGI----PPLVLAGRFRLQRGDPAALTARMKAIAAERKQKTPAGSSCGSVFKNPAGDFAGRLIEAAGL 242
148657889 240 KGTRIGNAEIALRHANYIINLGGASSDDVLRLIDLARERVLAISGIELELEIQIVG 295
156741079 240 KGRRIGNAEIAARHANYIINLGGASSDDVLRLIDLARERVLALTGIELELEIQIVG 295
163846335 243 KGVRIGDAEISTLHANYIINRGQARAADILALIDLARTKVADQFGITLQLEVRII- 297
159900024 241 KGFRMGAAQIAEKHANYILNLGGATANDILRVAEYAQTEVLKQFGIELELEVRVIT 296
219849720 243 KGTRVGDAEISPIHANYIVNRGQARAADILTLIELARTTVAEQFGVMLQLEVRVI- 297
222524100 243 KGVRIGDAEISTLHANYIINRGQARAADILALIDLARTKVADQFGITLQLEVRII- 297
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap