Conserved Protein Domain Family
PRK14648

?
PRK14648: PRK14648 
UDP-N-acetylmuramate dehydrogenase
Statistics
?
PSSM-Id: 173111
View PSSM: PRK14648
Aligned: 2 rows
Threshold Bit Score: 720.354
Threshold Setting Gi: 189025324
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189025324   1 MSAHRIRARRITRRNVPLAERCSFRIGGAAQFWAEPRSCTQLRALIEEAQRARIPLSLIGGGSNVLIADEGVPGLMLSLR 80 
15639084    1 MSAHRIRARRITRRNVPLAERCSFRIGGAAQFWAEPRSCTQLRALIEEAQRARIPLSLIGGGSNVLIADEGVPGLMLSLR 80 
189025324  81 RFRSLHTQTQRDGSVLVHAGAGLPVAALLAFCAHHALRGLETFAGLPGSVGGAAYMNARCYGRAIADCFHSARTLVLHPV 160
15639084   81 RFRSLHTQTQRDGSVLVHAGAGLPVAALLAFCAHHALRGLETFAGLPGSVGGAAYMNARCYGRAIADCFHSARTLVLHPV 160
189025324 161 RSRAKELPEVRKNAQDKRGECLGLDGGPFTCSSFQTVFARAGDWGYKRSPFQSPHGVELHAGRRLILSLCVRLTPGNPAQ 240
15639084  161 RSRAKELPEVRKNAQDKRGECLGLDGGPFTCSSFQTVFARAGDWGYKRSPFQSPHGVELHAGRRLILSLCVRLTPGNPAQ 240
189025324 241 IRKHMQEKIADRISKGQFRFPSAGSAFKNNPAFGKPSGILIEEAGLRGTSCGAAQVAPWHGNLIINTGNATAHQVRTLLR 320
15639084  241 IRKHMQEKIADRISKGQFRFPSAGSAFKNNPAFGKPSGILIEEAGLRGTSCGAAQVAPWHGNLIINTGNATAHQVRTLLR 320
189025324 321 VVRQRVFETHGVWLEREIIFSGESVRMTSSSRDS 354
15639084  321 VVRQRVFETHGVWLEREIIFSGESVRMTSSSRDS 354
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap