Conserved Protein Domain Family
PRK14647

?
PRK14647: PRK14647 
ribosome maturation factor RimP
Statistics
?
PSSM-Id: 173110
View PSSM: PRK14647
Aligned: 8 rows
Threshold Bit Score: 277.784
Threshold Setting Gi: 189424725
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
197117687   1 MAKVDVVERVTEIIAEVGAPLGIELVDLEYKREGRDMVVRVFLEKrEGGINLDDCADVSRQLSDILDVEDFMPERYTLEV 80 
118579396   3 LHRDDICDRIRTLALPVIDSMNLELVEVEYKRSGREAVLRLFIDK-EGGVTLDDCADLSRELSTLLDVEDLIPCEYSLEV 81 
148263955   1 MAKVDVISRVTVLAEQVISSLGMELVDLEYKREGREMVLRLFVDK-EGGVNLDDCASVSRELSEVLDVEDVISEHYSLEV 79 
78222793    1 MAKDEVVDRVTALAESLLSSQEMELVDIEYKREGRHMVLRLFVDK-AGGITLDDCALVSREFSEILDVEDFISENYTLEV 79 
39996685    1 MQKDDVAGRITAVAEQVLTPQGLELVEVEYKREGRQMVLRLFVDK-PGGISLDDCAAVSRELSEILDVEDFIRENYTLEV 79 
222055778   1 MAKVDVVSRVTELAEQVLSSLGMELVELEYKHEGRELVLRLFIDK-EGGVTLDDCESVSRDLSQILEVEDIITGHYRFEV 79 
189424725   1 MSATDPIQRVETLLQPILDAMGLELVELEFKKVGRSYLLRVFIDK-PDGVNLDDCAEVSRELSVQLDVEDCIASRYTLEV 79 
253701582   1 MAKVDVVERVTEIIAEVGAPLGIELVDLEYKREGRDMVVRVFLEKrEGGINLDDCAEVSRQLSDILDVEDFMPERYTLEV 80 
197117687  81 SSPGICRPLKKVADYERFLGHLIKVKTFEMLADEAGNKRKTFTGKLTGIADGVIGIDLTEGQKARVPLDKVAKANLEFEF 160
118579396  82 SSPGLDRPLKSEADYERFSGRLIKVRTYEPYQDDAGNRRKTFLGRLEGLKDGSVVMSLTEGQTASIPLERIAKAQLEFEF 161
148263955  80 SSPGIDRPLKKVEDFQRFKGRLVKIRTFEPLPDDAGNKRKTFLGELKGIENGVVLVALKEGQNAAIPFEKVAKANLEFEF 159
78222793   80 SSPGLNRPLKRESDYERYRGRLVKVRTYDVVEDEAGNRRKTFLGDLEGLAGGVVTLKLREGQMARIPLAKIAKANLEFEF 159
39996685   80 SSPGLNRPLKKEADYERYAGRLVKVRTFELLADEEGNRRKTFLGDLVGLSDGVVTLTLREGQLARIPLDKIAKANLEFEF 159
222055778  80 SSPGLDRPLKKGSDYEKYAGRLVKIRTFEALADDAGNKRKTFLGELKGLKEGQVHIALKEGQSAVIPLDKIAKANLEFEF 159
189424725  80 SSPGLDRPLKKEQDFIRYQGRLAVVKTTELLKDEKGSPRKTFLGFLEGVEDGEVMIRLKEGPQARIPWDKIAKAHLEFEF 159
253701582  81 SSPGICRPLKKVVDYERFMGHLIKVKTFEMLPDEAGNKRKTFTGKLTGIADGVIGIDLTEGQHARVPLDKVAKAHLEFEF 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap