Conserved Protein Domain Family
PRK14646

?
PRK14646: PRK14646 
ribosome maturation factor RimP
Statistics
?
PSSM-Id: 173109
View PSSM: PRK14646
Aligned: 6 rows
Threshold Bit Score: 229.831
Threshold Setting Gi: 123966904
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33862047    1 MDKECKSNLESLLQGVAKEFNLKIHSLDILTNQNPIIVKIIICKTNKDDITLDDCSRFNNPAISVIENSNLLNCSYVLEI 80 
78779968    1 MNKEQKSRLENLLEKVANVLDYKICSVNLQTNQNPIVIKIIIKKTNGDDISLDDCALFNTPASEEIENSNLLKCSYVLEI 80 
157414093   1 MYKENKNKLEILLKKVANEWDLKICSINIQTNQNPTVVKIIIKKTNGDDISLEDCALFNAPASEEIENSNLLNCSYVLEI 80 
123969227   1 MNKENKSKLEALLEKVANERDLEICGLNIQTNQNPVVIEITIRKTNGDDISLDDCALFNTPASDEIEKSNLLNCSYVLEI 80 
123966904   1 MDKELKNNLEILLEEVAKEFNLKVYSLNLLTNQNPIIIKIIIKKTNEEDITIEDCSRFNNPASAVIENSNLLKCSYVLEI 80 
126697020   1 MNKENKSKLEKLLENVANKQDLEIYSLNIQTNQNPIVIEIIIKKTNGNDVSLDDCALFNTPASDEIEKSNLLNCSYVLEI 80 
33862047   81 SSQGVSDELTSERDFKTFKGFPVNVELNQKNSQIKFLNGLLYEKSKDYLAINIKGKIKKIPFNEVLKVSLCTFKD 155
78779968   81 SSQGVSDELTSERDFKTFKGFPVNVELNQKNSKIKFLNGLLYEKSKDYLAINIKGKIKKIPFNEVLKISLCTLKD 155
157414093  81 SSQGVSDELTSDRDFKTFKGFPVNVQLNQKNSKKKFLNGLLYEKSNDYLAINIKGKIKKIPFDEVLKISLCTLKD 155
123969227  81 SSQGVSDELTSERDFKTFKGFPVNVELNQKNSKIKILNGLLYEKSKDYLAINIKGKIKKIPFDEVLKISLCTLKD 155
123966904  81 SSQGVSDELTSERDFKTFKGFPVNVELNQKNSRIKLLNGLLYEKSKDYLAINIKGKIKKIPFNEVLKISLCTRQD 155
126697020  81 SSQGVSDELTSERDFKTFKGFPVNVELNQKNSKIKFLNGLLYEKSNDYLAINIKGRIKKIPFDEVLKISLCTLKD 155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap