Conserved Protein Domain Family
PRK14643

?
PRK14643: PRK14643 
ribosome maturation factor RimP
Statistics
?
PSSM-Id: 173106
View PSSM: PRK14643
Aligned: 3 rows
Threshold Bit Score: 239.404
Threshold Setting Gi: 50365107
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
83319689   1 MKDFESIKFQINELVNKELEVLNLKVYEINNLKEFENDMIQILVEDALQANKPLDFDILIKANDLVSNKIDQIIKTNQKY 80 
42560897   1 MKDFESLKFQINELVNKELEVLNLKVYQINNLKEFENDMIQILVEDSLQANKPLDFDILIKANDLVSNKIDQLIKTKDKY 80 
50365107   1 MKNFASIKDEIQKIAESILKEYNLQIYEINNFFDFESDVLQILVEDITEPNKALDFDSIISSNEKLSDALENFPGLSEPY 80 
83319689  81 LLEISSSGIEKQIRSQEELIKALDQWVYVQLNNEIKKVKEFEGYVTKYNNDTNTFSFLFFIKGQKKTLEVMWNNIKFIRY 160
42560897  81 LLEISSSGIEKQIRSQEELLKALEQWVYVQLNNEIKKVKEFEGYVTKYNDQTNTFTFSFFIKGQKKNLDVKFDDIKFIRY 160
50365107  81 MLEVASAGIEKPIRSKDELVKAVNSYIHVELNQEKNTSSEIEGILLDFDVNKDTFRITYFLKGQKKKVDFKYEQVKFARY 160
83319689 161 AVRF 164
42560897 161 AVRF 164
50365107 161 AVKF 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap