Conserved Protein Domain Family
PRK14641

?
PRK14641: PRK14641 
ribosome maturation factor RimP
Statistics
?
PSSM-Id: 173104
View PSSM: PRK14641
Aligned: 5 rows
Threshold Bit Score: 265.1
Threshold Setting Gi: 145220366
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119356206   1 MEEKIRRCVLQVLEATAGTKGEGVYLVSLSIKGSGKGTSIEVLVDTDTGIRIDQCAFLSRRIRECLEVEEESDGMSGDDF 80 
78187635   20 IDSHIEGIVQNILEDSVGTKGEGVYLVAMTVKGSAVHRKIEVILDADSGVRIDQCSFFARRIRERLEEDEALSGTMGEDF 99 
145220366   1 MQEALLKCVHEVLSATAGTKAEGVYFIGMTVKGSVVHRKIDVVVDADSGVRIDQCAFLSRRLRERLEEDEEMIGILGDNF 80 
189345842   4 MEEKIKACVLQALESAAGTKGEGVYLVSVRVKGAGKQTKIEILLDSDTGIRIDQCSFFSRRIRELLENEGGTPVLDGEDF 83 
194335548   1 MQERINNCVTQVLAESAGTRGEGAYLIDIKVKGKGSGRKIEILMDADDGIRIHQCAYISRRVRERIEGDDDLLELVGENF 80 
119356206  81 NLDVASPGLGKAIILQRQYARHVGRLFRVTFREEDGSMTEISGHLREILFPEEeNASLVIEPLGKKKAGKKVSSENRTLR 160
78187635  100 DLVVGSPGLGEPLVLRRQYGRHVGRLLRVWYRDTEGVEHEVAGHLQAVSLTEG-GGSITLKPQTAKKKGRQEETEDMTLE 178
145220366  81 DLVVGSPGLGEPIILDRQYGRHVGRLLRVSYSDLEGVEHELTGHLLEVSLAEG-AGSIMLKPRVEKKKGKGEELENITLE 159
189345842  84 DLMVSSPGLGEPLLMPRQYLRHTGRLLRVIWKDEQQSEKTVTGRLQQVLKTEGeITAVRLVPVKTGKKSAGNVQEPIELM 163
194335548  81 DLMVSSPGLGEPIIIPRQYIRHVGKLLQVTYADSNGDPVELVGHLQEVSLLDEhGAKIVIMPEQKKKKGQQPKTEAVILY 160
119356206 161 LDRVIRAVPEAEL 173
78187635  179 LDAVSRAVPEAEI 191
145220366 160 LGAVLRAVPEAEI 172
189345842 164 LDCIVRAVPEAEL 176
194335548 161 LNQVIRAIPEAEL 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap