Conserved Protein Domain Family
PRK14640

?
PRK14640: PRK14640 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 173103
View PSSM: PRK14640
Aligned: 3 rows
Threshold Bit Score: 323.884
Threshold Setting Gi: 117618499
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
237808992   1 MATLEQRLTELLDAPIVALGYELWGIEFIRAGKHSTLRVYIDHANGISVDDCAEASHQVSALLDVEDPITTEYYLEVSSP 80 
145298042   1 MATLEQRLTDLLEAPVVALGFELWGIEFIRAGNHSTLRVFIDGENGVTVENCAEVSHQVGAIMDVEDPITEEYFLEVSSP 80 
117618499  24 LATLEQRLTDLLEAPVVALGFELWGIEFIRAGKHSTLRVYIDGEHGVSVENCAEVSHQVGAIMDVEDPITEEYYLEVSSP 103
237808992  81 GMDRPLLKPEHFARYIGQVATVTLRMAVNNRRKYKGTIKQVDGEMITLTIDGRDEILAFANIQQANLIPNFD 152
145298042  81 GLDRPLFKVAQFEKYVGQEAAVQLRMATNNRRKFKGVIKAVQGDMITLTVDGKDDVLAFTNIQKANIVPNFG 152
117618499 104 GLDRPLFKVAQFEKYVGQEAAVTLRMATNNRRKFKGVIKAVQGDMITLTVDGKDEVLAFTNIQKANIVPNFG 175
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap