Conserved Protein Domain Family
PRK14639

?
PRK14639: PRK14639 
ribosome maturation factor RimP
Statistics
?
PSSM-Id: 173102
View PSSM: PRK14639
Aligned: 10 rows
Threshold Bit Score: 228.167
Threshold Setting Gi: 154148890
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157414451   1 MNLEALCKEAGLSFYDDELVSENGRKIYRIYVQKEGGVNLDDCARLSEILSPIFDVEPPVNGEYFLEVSSPGLERKLSKI 80 
157164808   2 DNLDKLIRECGVELYDSEIANENGRAIFRVYITKDGGVSLDDCEKVSRLLSPIFDVTPPVSGDYNLEVSSPGLERKLSKP 81 
153952308   1 MNLEALCKEAELSFYDDELVSENGKKIYRIYVQKEGGVNLDDCARLSEILSPIFDVEPPVNGEYFLEVSSPGLERKLSKI 80 
154174423   2 DNLNELVKECGVELYDTEIANENGRAIYRIYITKNGGVSLDDCEKVSRLLSPIFDVEPPISGDYNLEVSSPGLERKLSEA 81 
154148890   2 IDLNALCSECGVKFYADELISENSRQIYRVYITKKNGVNLDDCEALSRLLSPILDVEPPTSGAFTLEVSSPGLERKLTTP 81 
121613126   1 MNLEALCKEAELSFYDDELVSENGRKIYRIYVQKEGGVNLDDCARLSEILSPIFDVEPPVNGEYFLEVSSPGLERKLSKI 80 
118474205   2 TDLSNLVSQCGVDLYDAEVVNENGRVIYRVYITKNGGVSLEECEAVSKLLSPIYDVMPPVSGEWILEVSSPGLERKLSKI 81 
57237145    1 MNLEALCKEAGLSFYDDELVSENGRKIYRIYVQKEGGVNLDDCARLSEILSPIFDVESPVNGEYFLEVSSPGLERKLSKI 80 
222823265   1 MNLEALCKEAGLSFYDDELVSENGKKIYRVYVQKEGGVKLDDCARLSEILSPIFDVEPPVSGEYFLEVSSCGLERKLSKI 80 
218561819   1 MNLEALCKEAGLSFYDDELVSENGRKIYRIYVQKEGGVNLDDCARLSEILSPIFDVESPVNGEYFLEVSSPGLERKLSKI 80 
157414451  81 EHFAKSIGELVKITTnEKEKFEAKIIAVDDENITLENleNKEKTTINFNDIKKARTFVEW 140
157164808  82 SHFKASVGELVKVQT-EAEKFAGRLVKADEESIAVEN--EEGIFEINISEIKKAKTYLEW 138
153952308  81 EHFAKSIGELVKITTnEKEKIEAKIIAVDDENITLENleNKEKTTINFNDIKKARTFMEW 140
154174423  82 RHFKASLGELVKAQTaE-AKFAGRLVKADDESIALEN--DEGVFEIKIGDIKKAKTYLEW 138
154148890  82 SNFENSLGELVKITLkNGEKISGEILSFKDEILKLKTaeNNE-ISVNFNEIKKAKTYIEW 140
121613126  81 EHFAKSIGELVKITTnEKEKFEAKIIAVDDENITLENleNKEKTTINFNDIKKARTFIIW 140
118474205  82 EHFTLSIGEFAKIILnDKTEIKGKIVSVKDDNICI-NikNNESIEVKFENIKKAKTYMEW 140
57237145   81 EHFAKSIGELVKITTnEKEKFEAKIIAVDDENITLENleNKEKTTINFNDIKKARTFVEW 140
222823265  81 EHFAKSINELVKITTsEKEKIEAKIVSVDDENITLENlkTQEKTTLKFSDIRKARTFVEW 140
218561819  81 EHFAKSIGELVKITTnEKEKFEAKIIAVDDENITLENleNKEKTTINFNDIKKARTFVEW 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap