Conserved Protein Domain Family
PRK14634

?
PRK14634: PRK14634 
ribosome maturation factor RimP
Statistics
?
PSSM-Id: 173097
View PSSM: PRK14634
Aligned: 7 rows
Threshold Bit Score: 273.209
Threshold Setting Gi: 78184172
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33865135   12 LPHPLLPELETLATSVAADQGFELCGIQLLTHLAPMTLEVHIRRSNGVDVNMDDCAGFSGTLGEALESAQLLTEAYVLEI 91 
33863792    1 MPHPLLPDLETLASATAAGKGYKLCCVQVFTHLIPMTIQVQIRRKDGSDVSLDDCAHFSASMDEALEASQLFTEAYVLEI 80 
113954072   3 LPHPLLPDLKDLASATAVDHGFELADLQVLAHMQPMTVQIQIRRSSGDDVTLDDCAAFSAPMGEALENSAVLNEAYVLEI 82 
78184172   12 LPHPLLPELEQLTQRVAGLQGFELCGIQLLTHMNPITLQVQIRHTSGSDVNLDDCAGFSGVLGEALEESQQLVEAYVLEI 91 
78213594    1 MPHPLLPDLETLATKVAASKGFALCGIQLLTHMSPMTLEVQIRHSSGADVSLDDCAGFSGVLGDALEASTLLTDAYVLEI 80 
148240412   1 MPHPLLPDITPVAASTAAAHGFELVEIQILTHLQPMTVQVQIRRTDGSDVSLDDCAGFSGPMGEALESQALLTEAYVLEI 80 
124022126   1 MPHPLLPDLETLASATATGKGYKLCCVQVFTHLIPMTIQVQIRRKDGSDVSLDDCAHFSASMDEALEASQLFTEAYVLEI 80 
33865135   92 SSPGIGETLSSDRDFQTFRGFPVEVVHRDRDdTEQRLEGLLLERDEDTLQINIRGRIKRLPRDHVLSVRLTSPGS 166
33863792   81 SSPGIGDQLHSDQDFLTFRGFPVEISFRDHD-SDLHQAGLLHKRSDEHVHINIKGRIQRIPRKAVTCVRLTNPTG 154
113954072  83 SSPGIGDHLQSDRDFQTFRRYPVDVIHRDPDgAEQKHSGTLLERTENHLKISIHGRIKQIPRDSILSVELTNPTG 157
78184172   92 SSPGIGEQLSCDRDFQTFRGFPVDVTHRDQGnVEHRLEGLLHERNTDSLQINIRGRIKSIPRDQVIEVRLTTPGQ 166
78213594   81 SSPGIGDQLSSDRDFETFRGFPVEVHHRDKDdSEQRLEGLLLERDADTLQINIRGRIKRIARDCVIGVRLTSPGS 155
148240412  81 SSPGIGEQLQSDRDFQTFRSYPVEVLYRDDEgREQRQQGSLLERNADHVQVNVRGRIKRIARASVISVQLISPTG 155
124022126  81 SSPGIGDQLHSDQDFLTFRGFPVEISFRDDD-SDLHQAGLLHKRSDEHVHINIKGRIQRIPRKAVTCVRLTNPTG 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap