Conserved Protein Domain Family
PRK14633

?
PRK14633: PRK14633 
ribosome maturation factor RimP
Statistics
?
PSSM-Id: 173096
View PSSM: PRK14633
Aligned: 9 rows
Threshold Bit Score: 272.996
Threshold Setting Gi: 167627170
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118498224   1 MLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENGVSVDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMN 80 
134301262   1 MLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENGVSVDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMN 80 
89257074    1 MLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENGVSVDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMN 80 
110669697   3 MLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENGVSVDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMN 82 
115315430   3 MLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENGVSVDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMN 82 
56707227    3 MLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENGVSVDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMN 82 
169656764   3 MLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENGVSVDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMN 82 
167627170   1 MLLDDLYEIVEPITADLGYILWGIEVVGAGKLTIRIFIDHENGVSVDDCQVVSKEVSAIFDVEDPISDKYVLEVSSPGMN 80 
187931004   1 MLLDDLYEIVEPITADLGYILWGIEVVGSGKLTIRIFIDHENGVSVDDCQIVSKEISAVFDVEDPVSGKYILEVSSPGMN 80 
118498224  81 RQIFNIIQAQALVGFNVKAVTLAPVGSQTKFKGVLERVEGNNVILNLEDGKEISFDFDELKKLRVSPDFS 150
134301262  81 RQIFNIIQAQALVGFNVKAVTLAPVGSQTKFKGVLERVEGNNVILNLEDGKEISFDFDELKKLRVSPDFS 150
89257074   81 RQIFNIIQAQALVGFNVKAVTLAPVGSQTKFKGVLERVEGNNVILNLEDGKEISFDFDELKKLRVSPDFS 150
110669697  83 RQIFNIIQAQALVGFNVKAVTLAPVGSQTKFKGVLERVEGNNVILNLEDGKEISFDFDELKKLRVSPDFS 152
115315430  83 RQIFNIIQAQALVGFNVKAVTLAPVGSQTKFKGVLERVEGNNVILNLEDGKEISFDFDELKKLRVSPDFS 152
56707227   83 RQIFNIIQAQALVGFNVKAVTLAPVGSQTKFKGVLERVEGNNVILNLEDGKEISFDFDELKKLRVSPDFS 152
169656764  83 RQIFNIIQAQALVGFNVKAVTLAPVGSQTKFKGVLERVEGNNVILNLEDGKEISFDFDELKKLRVSPDFS 152
167627170  81 RQIFNIIQAQALVGFNVKAVTLTPVESQTKFKGVLERVEGNNVILKLDDGREVSFDFDELKKFRVSPDFS 150
187931004  81 RQIFNIIQAQALVGFNVKAVTLAPVGSQTKFKGVLERVEGNSVILNLEDGKEISFDFDELKKLRVSPDFS 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap