Conserved Protein Domain Family
PRK14632

?
PRK14632: PRK14632 
ribosome maturation factor RimP
Statistics
?
PSSM-Id: 173095
View PSSM: PRK14632
Aligned: 3 rows
Threshold Bit Score: 209.538
Threshold Setting Gi: 46578926
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218887602   1 MSTYPLRDAVAAIATPLADALGIALWGIEIIDGGRMVLRVYVDAkpgmpvpadtaeatesatpegvalegstPEGVTIDQ 80 
46578926    1 MTKQALDATIADMAGPFLASLGLELWGIELSYGGRTVVRLFVDG----------------------------PEGVTIDQ 52 
120603473   1 MTKQALDATIADMAGPFLASLGLELWGIELSYGGRTVVRLFVDG----------------------------PEGVTIDQ 52 
218887602  81 CARLSRQLGLALDVEDVVRDAYVLEVSSPGLERPFFEIAQVVPYVGRTIELTLAVPHPEWPGRRKFRADIVRVEGDTLTF 160
46578926   53 CAEVSRHVGLALEVEDVISSAYVLEVSSPGLERPFFRAEQMSPYVGRQIELTLIDPTPEWPGRRKFRGELLAVEGDTVVL 132
120603473  53 CAEVSRHVGLALEVEDVISSAYVLEVSSPGLERPFFRAEQMSPYVGRQIELTLIDPTPEWPGRRKFRGELLAVEGDTVVL 132
218887602 161 LPDTAPRPDEDPAPISVAWDDVKKAHLIHVFPDttrpqPGGKtgqrkkaqPKK 213
46578926  133 RPEGAPAPEAEEAVLRTSWQGVRKANLIHVFPE-----PGHK--------PRR 172
120603473 133 RPEGAPAPEAEEAVLRTSWQGVRKANLIHVFPE-----PGHK--------PRR 172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap