Conserved Protein Domain Family
PRK14630

?
PRK14630: PRK14630 
ribosome maturation factor RimP
Statistics
?
PSSM-Id: 173093
View PSSM: PRK14630
Aligned: 8 rows
Threshold Bit Score: 210.037
Threshold Setting Gi: 218249670
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218249670   1 MIKYFDkNNEVFNLIKDLTGRLNVEILEINIFRNKNNGKIQIVLYSKNfSLDIDFLTDLHKIILLILEANLKYGFTLELS 80 
187918653   1 MVKIVD-NSEVYNLIKNVTDRLGIEIIEINTFRKRGEGRVQIVLYKGD-DFGVDTLCDLHKMILLNLEAVLKYNFSLEIS 78 
203284695   1 MVKISD-NSEIYDLIKDVTYLLGISIIEINTFRRRDEFKIQIVLYKSD-NFSVDMLCDLHKMILLKLEAVLKYNVSLEIS 78 
203288227   1 MVKISD-NSEIYDLIKDVTYLLGISIIEINTFRKRDEFKIQIVLYKSD-NFSVDMLCDLHKMILLKLEAVLKYNVSLEIS 78 
51599051    1 MIKCFDkNNEVYNLIKNLTERLNIEILEVNIFRNKNGGKIQIVLYSKDfSLGIDLLTDLHKMILLILEASLEYSFTLELS 80 
15595144   18 LIKYFDkNNEVFNLIKDLTGRLNVEILEINIFRNKNNGKIQIVLYSKNfSLDIDFLTDLHKMILLILEANLKYGFTLELS 97 
111115634   1 MIKCFDkNNEVYNLIKNLTERLNVEILEINIFRNKNGGKIQIVLYSKNfSLGIDLMTDLHKMILLILEANLKYSFILELS 80 
119953576   1 MVKIID-NSEVYNLIKNVTDQLGIEIIEINTFKKRDEGRIQIVLYKGN-DFGVDTLCDLHKMILLSLEVVLKYNFSLEIS 78 
218249670  81 TPGIDRKIKSDREFKIFEGKKIKLMLDNEFEEGFILESKPKSFIFKTDSKEVNVFYSDVKKARLV 145
187918653  79 TPGINRKIKSDREFKIFEGKKIKLMLDNDFEEGFILKAGADSFIFKTDNKEVKVLYSDVKKAKLS 143
203284695  79 TPGINRKIKSDREFKIFEGKKIKLMLNNDFEEGFILRAERDGFIFKTEYKEVKILYSNVKKAKLS 143
203288227  79 TPGINRKIKSDREFKIFEGKKIKLMLNNDFEEGFILRAERDGFIFKTEYKKVKILYSNVKKAKLS 143
51599051   81 TPGIDRRIKSDREFQIFEGKKIKLMLDNEFEEGFILESKSKSFIFKTESKELNVSYSDVKKARLV 145
15595144   98 TPGIDRKIKSDREFKIFEGKKIKLMLDNEFEEGFILESKPKSFIFKTDSKEVNVFYSDVKKARLV 162
111115634  81 TPGIDRRIKSDKEFQIFEGKKIKLMLDNEFEEGFILEAKSKSFIFKTDSKELNVFYSDVKKARLV 145
119953576  79 TPGINRKIKSDREFKIFEGRKIKLMLDNDFEEGLILKAEADGFIFKTDTKEIRILYSDVKKAKLS 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap