Conserved Protein Domain Family
PRK14629

?
PRK14629: PRK14629 
YbaB/EbfC family nucleoid-associated protein
Statistics
?
PSSM-Id: 173092
View PSSM: PRK14629
Aligned: 8 rows
Threshold Bit Score: 155.529
Threshold Setting Gi: 51598718
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119953250   1 MAVNPLDFLKNMSGFKDNIDNFKKEISQIVVCGRAGSDVVVVEMNGEFVVKKVVIKEEFFSDLDNEALEHMIKSAFNDAI 80 
111115292   1 MAVNPLDFLKNMSSVKSNIDNIKKEMSKITVCGKAGSNIVTIEMDGEFNVKKVSINKEFFDDLDNDAFEQMVKSALNDAV 80 
15594807   12 MAVNPLDFLKNMSSVKNNIDNIKKEISKITVCGKAGSNIVTIEMDGEFNVKKVSINKEFFDDLDNDAFEQMIKSALNDAV 91 
51598718    1 MAVNPLDFLKNMSSVKNNIDNIKKEMSKITVCGKAGSNIVVIEMDGEFNVKKVSINKEFFDDLDNGAFEQMVKSALNDAV 80 
218249845   1 MAVNPLDFLKNMSSVKNNIDNIKKEISKITVCGKAGSNIVAIEMDGEFNVKKVSINKEFFDDLDNDAFEQMIKSALNDAV 80 
203287905   1 MAVNPLDFLKNMSNFKDNIDNIKKEISQIVVCGRAGSDVVVVEMNGEFVVKKILIKEDFFNDLDNEALEHMIKSAFNDAV 80 
203284371   1 MAVNPLDFLKNMSNFKDNIDNIKKEISQIVVCGRAGSDVVVVEMNGEFVVKKILIKEDFFNDLDNEALEHMIKSAFNDAV 80 
187918327   1 MAVNPLDFLKNMTSFKDNIDNLKKEMSQIVVCGRAGSDVIVVEMNGEFLVKKVSIKEEFFSDLDNEALEHMIKSAFNDAI 80 
119953250  81 SKVKEEIKSKTMGSIPFGI 99 
111115292  81 SKVKEEIKLKTMGVLPFGM 99 
15594807   92 SKVKEEIKLKTMGVLPFGM 110
51598718   81 SKVKEEIKLKTMGVLPFGM 99 
218249845  81 SKVKEEIKLKTMGVLPFGM 99 
203287905  81 FKVKEEIKSKTMGSIPFGI 99 
203284371  81 FKVKEEIKSKTMGSIPFGI 99 
187918327  81 SKVKEEIKSKTMGSMPFGI 99 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap