Conserved Protein Domain Family
PRK14628

?
PRK14628: PRK14628 
YbaB/EbfC family nucleoid-associated protein
Statistics
?
PSSM-Id: 173091
View PSSM: PRK14628
Aligned: 6 rows
Threshold Bit Score: 149.007
Threshold Setting Gi: 222100873
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222100873   1 MKKIKSFGGKSLGGgkqeKLLKDFMKMQEELQKKMQEMEESFSEMEVEASVGGGAVRIVATCDRRVKEIEIDEDLKEDLE 80 
217077442   1 MKKLKSFGGKNLSG----KSMNQLQKLQEEMQKKLQEVEEGFSNVEVEVSVGGGAIKILATADRKVKDIEIDEDLLSDGE 76 
15643450    1 MKKIKSFGGKSLGGgkqeKILKDFARMQEELQKKIQELEESFSQIEVEASVGGGAVRIVATCDRRVKDIEIDEDLKEDFD 80 
150020440   1 MKKLKSFGGKNLGG----KSMNQLQKLQEEMQKKLQEVEEGFSNVEVDVSVGGGAIKIFATADRKVKDIEIDEDLLEDTE 76 
148269389   1 MKKIKSFGGKNLGGgkqeKLLKDFAKMQEELQKKIQELEESFSQIEVEASVGGGAVRIVATCDRRVKDIEIDEDLKEDFD 80 
281411914   1 MKKIKSFGGKNLGGgkqeKLLKDFAKMQEELQKKIQELEESFSQIEVEASVGGGAVRIVATCDRRVKDIEIDEDLKEDFD 80 
222100873  81 TLKDLLAAAVNEIMEKIEKRREEEMSKITQQFgIPGLM 118
217077442  77 TLKDLLTAGINELMEKIEKIREEEMAKVTQNL-LPFGF 113
15643450   81 TLKDLLIAGMNEVMEKIEKRREEEMSKITQQFgIPGLM 118
150020440  77 TLNDLLIAGINELMEKIEKIREEEMAKITQNF-LPF-- 111
148269389  81 TLKDLLIAGMNEVMEKIEKRREEEMSKITQQFgIPGLM 118
281411914  81 TLKDLLIAGMNEVMEKIEKRREEEMSKITQQFgIPGLM 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap