Conserved Protein Domain Family
PRK14626

?
PRK14626: PRK14626 
YbaB/EbfC family nucleoid-associated protein
Statistics
?
PSSM-Id: 173089
View PSSM: PRK14626
Aligned: 3 rows
Threshold Bit Score: 133.828
Threshold Setting Gi: 225848979
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
188997276   1 MFNFGNLAELMKQAQSIKENVEKAKEELKNEKIVVEVGGGMVKVVSDGLGTVLDLEIDKSLLNENEYPVLKDLLIAAINE 80 
225848979   1 MFNFGNLAELMKQFQMIKENVEKAKEELKKENVVVEVGGGMVKVVSNGLGEIVDIEIDKSLLNEQEYQVLKDLLISAVNE 80 
225850088   1 MFNLGNLGEMMKMMKSMQENIEKAKEELRKEEIVVEVGGGMVKVILNGLGEIKDVLIDKTLLTEDNHEILQDLLVAAFNE 80 
188997276  81 VSERSKEVVADKISQATGLPMNMSKFGGMF 110
225848979  81 ASDRSKELMTQKLTEASGLPSSFSKFGGLF 110
225850088  81 ANRRTKEVMGEKMTQAAGLPSNIPGLGNLF 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap