Conserved Protein Domain Family
PRK14624

?
PRK14624: PRK14624 
YbaB/EbfC family nucleoid-associated protein
Statistics
?
PSSM-Id: 173087
View PSSM: PRK14624
Aligned: 6 rows
Threshold Bit Score: 183.998
Threshold Setting Gi: 189912833
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189912833   3 IFDQMKQMREAFSQLGNIKEKQEELQKRLAQIRVTASAGAGMVEVTATADGTLTNLNINPIMFNADDKKMLEDLILSATN 82 
116326906   1 MLDKIKNLSELLSNMGALREKMEDVKKRIASIRVVGDAGAGMVTVTATGEGQIINVFINKQLFDSDDNKMLEDLVMAATN 80 
116332430   1 MLDKIKNLSELLSNMGALREKMEDVKKRIASIRVVGDAGAGMVTVTATGEGQIINVFINKQLFDSDDNKMLEDLVMAATN 80 
24217031    1 MFDKIKNFSEILSNMGSFREKMEEVKKRIASIRVVGDAGAGMVTVTASGEGQITNVFINKQLFDADDNKMLEDLVMAATN 80 
45659290    1 MFDKIKNFSEILSNMGSFREKMEEVKKRIASIRVVGDAGAGMVTVTASGEGQITNVFINKQLFDADDNKMLEDLVMAATN 80 
183222801   3 IFDQMKQMREAFSQLGNIKEKQEELQKRLAQIRVTASAGAGMVEVTATADGTLTNLNINPIMFNADDKKMLEDLILSATN 82 
189912833  83 EVQRKAKETMAHEMKNVLGfnPSDFEGVFNQFQKDGG 119
116326906  81 DALKKAKEATAYEFQAASG--GLDFSEISKMFGGNFG 115
116332430  81 DALKKAKEATAYEFQAASG--GLDFSEISKMFGGNFG 115
24217031   81 DALKKAKEATAYEFQSASG--GLDFSEISKMFGGKFG 115
45659290   81 DALKKAKEATAYEFQSASG--GLDFSEISKMFGGKFG 115
183222801  83 EVQRKAKETMAHEMKNVLGfnPSDFEGVFNQFQKDGG 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap