Conserved Protein Domain Family
PRK14622

?
PRK14622: PRK14622 
YbaB/EbfC family nucleoid-associated protein
Statistics
?
PSSM-Id: 173085
View PSSM: PRK14622
Aligned: 4 rows
Threshold Bit Score: 146.021
Threshold Setting Gi: 153006599
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
197124084   1 MDIQYLMRQAKKLEKAMADAKEKLAEIAVEAESGGGLVKVAMNGKCEITRLTVDPKAIDPNDKALLEDLVTAAVNAAVEK 80 
220918863   1 MDIQYLMRQAKKLEKAMADAKEKLAEIAVEAESGGGLVKVAMNGKCEITRLTVDPKAVDPNDKALLEDLVTAAVNAAVEK 80 
153006599   1 MDIQYLMRQAKKLEKAMADAKEQLAELSVEAESGGGLVKVTMNGKCEVTRLLVDPKAVDPADKAMLEDLVTAAVNAAVEK 80 
86160054    1 MDIQYLMRQAKKLEKAMADAKEKLAEIAVEAESGGGLVKVAMNGKCEVTRLTVDPKAIDPNDKAMLEDLITAAVNAAVEK 80 
197124084  81 ARTAADESMSKATGGIKIPGIAG 103
220918863  81 ARTAADESMSKATGGIKIPGIAG 103
153006599  81 ARAAADEHMARATGGIKIPGVAG 103
86160054   81 ARTAADESMSKATGGIKIPGIAG 103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap