Conserved Protein Domain Family
PRK14621

?
PRK14621: PRK14621 
YbaB/EbfC family nucleoid-associated protein
Statistics
?
PSSM-Id: 173084
View PSSM: PRK14621
Aligned: 11 rows
Threshold Bit Score: 145.355
Threshold Setting Gi: 193214869
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21673634   11 MAMPNFGDMMKQLQEAGAKMQDLQKQLEKLVSEGEAGGGMVRAKVNGRQKLLELTIDPEIMDDVDMVQDLVVAAVNKALE 90 
78189157    1 MAMPNLGDMMKQIQQAGEKMQEVQKQLERLVAHGEAGGGMVKATVSGKQKLLSLAIDPEIMDDYEMVQDLVVAAVNSALD 80 
78187145    1 MGMPNFGDMMKQIQQAGEKMQDVQKQLEKLVTSGEAGGGMVKVTVNGKQRVLSLWIDPEIMDDAEMVQDLVLAAVNSALE 80 
145219841   1 MEMPNLGDMMKQIQQAGAKMQDVQKQLEKTVTHGEAGGGMVKVSVNGRQRLLSLAIDPDIMDDREMVQDLVLAAVNSAIE 80 
119356988   1 MGMPNLGDMMKQIQQAGEKMQDVQKQLEKIVAYGEAGGGMVKVSVNGKQKLLTLQIDPDIMDDAEMVQDLVIAAVNSALD 80 
193212497   1 MAMPNFGDMMKQLQEAGAKMQDVQKQLEKLVSEGEAGGGMVKAKVNGRQKLLELSIDPEIMDDVDMVQDLVVAAVNKALD 80 
193214869   1 MQLGDMSAMLKQVQQMSEKMQEAQKQLESMTAIGESGGGLVKAMANGKHEIISIQIDKDVLDDVDMLQDLIVAAVNQALT 80 
194333713   8 MGMPNLNDMMKQLKQAGEKMQDVQKQLEKITAEGDAGGGMVRAVVNGKQRVLSVTIDPEIVDDVEMVQDLVVAAVNSALE 87 
194336272   1 MAMPNLGDMMKQIQQAGEKMQDVQKQLEKIVAHGEAGGGMVKVSVSGKQKLLSLTIDPDIMDDAEMVQDLVLAAVNNALD 80 
189500124   1 MAMPNFNDMMKQLQQAGAKMQDVQKQLEKITAVGDAGGGMVKATVSGKQKVLSIAIDPEILDDIEMVQDLVVAAVNAALE 80 
189346404   1 MGMPNLGDMMKQIQKAGEKMQDVQNQLEKLVAHGESGGGMVKVSVSGKQKLLSLRIDPEIMDDAEMVQDLVIAAVNNALD 80 
21673634   91 ASAQLAQSEIQKAAGGMINPADLMKQFGGQG 121
78189157   81 ASLKLAQDEIGKVTGGMMNPTELLKNLNLGQ 111
78187145   81 ASGRMAQEEISKVAGGMINPQDILKNLGQ-- 109
145219841  81 ESGRVSQEEIAKVAGGMINPADILKNMGK-- 109
119356988  81 EAAKVAQEELVKVTGGMMNPADILKNLNLGK 111
193212497  81 ASAQLAQNEIQKAAGGMINPADLLKQFGGQG 111
193214869  81 EATKMAQEEMSKVTGGMMGDMNFLKNLNMGG 111
194333713  88 NVTGLAQEEMSKVAGGMMGNQDFLKNFNFGQ 118
194336272  81 ESARLAQEEISKVTGGMMNPADILKNLNLGQ 111
189500124  81 KAADLAREELSKAAGGMLGGEDMLKNFNIGQ 111
189346404  81 ASAALAQEEISKAAGGMINPADILKNMNLGK 111
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap