Conserved Protein Domain Family
PRK14620

?
PRK14620: PRK14620 
NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 173083
View PSSM: PRK14620
Aligned: 9 rows
Threshold Bit Score: 519.005
Threshold Setting Gi: 57239388
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225630494   1 MAISILGAGAWGTAIAISLGSKK-DVILWTRNETTFESINGKRESDK-LPGCRISDNVSVKLAIEDTI--NASVTILAVP 76 
190570996   1 MVISVLGAGAWGTAIAISLSGKK-NVILWTRNKAIFESIKEKRESDK-LPDCPISDNVSVKLAIEDAV--NASVIILAVP 76 
88658270    1 MKTTILGAGSFGTAIAFALSSNStSVNLWGRNHTDMQSIAINRKNLKyLPTCKLPENIIVSSNIDEVLsdYSTCIILAVP 80 
73667281    1 MKITILGAGSFGTAIAIALSSIStSINLWGRNHTDMQSITINRKNLKyLPTYELPDNIIPSSSIDEVLsdHNTCIILAVP 80 
42520574    1 MAISILGAGAWGTAIAISLGSKK-DVILWTHNETTFESINGKRESDK-LPGCRISDNVSVKLAIEDII--NASVTILAVP 76 
57239388    1 MKISILGAGSFGTAIAIALSAHGiSVNLWGRDHRNTTHINTYRKNLKyLPTYHLPDNIYATSNIDEVLsdNNTCIILTIP 80 
58584854    1 MTISILGAGAWGTAIANSLSGKQ-NVILWTHNKTTFESISRTRESDK-LLGCQIPENVSVKLAIKETV--NASAMIFAVP 76 
58617410    1 MKISILGAGSFGTAIAIALSAHGiSVNLWGRDHRNITHINTYRKNLKyLPTYHLPDNIYATSNIDEVLsdNNTCIILTVP 80 
58579356    1 MKISILGAGSFGTAIAIALSAHGiSVNLWGRDHRNTTHINTYRKNLKyLPTYHLPDNIYATSNIDEVLsdNNTCIILTIP 80 
225630494  77 TQSLRKVCQQLHN-CNLKKDVAIILACKGIEKSTLKLPSEIVNEILPNNPIAIFSGPSFAVEVARKLPYSMVLACQNNTL 155
190570996  77 TQSLREICHQLND-CNLKKNVAIILACKGIEKSTLKLPSEVVNEVLPNNPLAVFSGPSFAIEVARKLPYSMVLACQNEVL 155
88658270   81 TQQLRTLCLSIQDkQHIFEKTPLLICSKGIENISLKFPSEIVKEILPNNPAFILSGPSFAKEIAEDLPCTIVLAGENESL 160
73667281   81 TQQLRTLCLYVQQ--HIFEQTPLLICSKGIENISLKFPSEIVKEILPNNPTYILSGPSFAKEIAANLPCTIVLAGENEVL 158
42520574   77 TQSLRKVCQQLHN-CNLKKDVAIILACKGIEKSTLKLPSEIVNEILPNNPIAIFSGPSFAVEVARKLPYSMVLACQNNTL 155
57239388   81 TQQLRTICTQIQHkQHMCKNTPILICSKGIEITSLKFPSEIAEEILQYNPIFILSGPSFAKEIAEHLPCSIVLAGDNKEL 160
58584854   77 TQSLRKVCQQLHD-CNLKKDVAIILACKGIEKSTLKLPSEIVNEVLPNNPVAIFSGPSFAIEVAKKLPYSMVLACQDDTL 155
58617410   81 TQQLRTICTQIQHkQHMCKNTPMLICSKGIEITSLKFPSEIAEEILQYNPIFILSGPSFAKEIAEHLPCSIVLAGDNKEL 160
58579356   81 TQQLRTICTQIQHkQHMCKNTPILICSKGIEITSLKFPSEIAEEILQYNPIFILSGPSFAKEIAEHLPCSIVLAGDNKEL 160
225630494 156 GSKLVSELQQENVKLEFSNDIIGVQICAALKNVFAIACGIVLGSkLGFNAHAALITKSMSEIKALYSAKigDGSVDINTL 235
190570996 156 GLKLVSELQQENIKLYLSSDVIGIQVCAALKNVFAIACGVVLGR-FGFNAHAALITKSMSEIKALYSAKvgDGNVDINTL 234
88658270  161 GTSIAQKISNKTFKIIYSQDILGVQIGAALKNIIAIACGIVTGKnLGNNAIATVITKGMEEIKTLYAAK--NQNINLSTL 238
73667281  159 GTSLINKMSNKTFKIVYSKDTLGVQIGAALKNIIAIACGIITGKnLGNNAVASVIAKGMEEIKTLYTAK--NETINLSTL 236
42520574  156 GSKLVSELQQENVKLEFSNDIIGVQICAALKNVFAIACGIVLGSkLGFNAHAALITKSMSEIKALYSAKigDGSVDINTL 235
57239388  161 GESLIEKISNDVLKIIYHQDIIGVQIGAALKNIIAIACGIIAGKnLGNNAVATVITKGMNEIKTLYIAK--NHSIDLHTL 238
58584854  156 GSKLISELQQENIKLHFSSDVVGVQICAALKNVFAIACGIVLGKkLGFNAHAALVTKSMNEVKTLYLAKtdSVSIDIDTL 235
58617410  161 GESLIEKISNDVLKIIYHQDIIGVQIGAALKNIIAIACGIIAGKnLGNNAVATVITKGMNEIKTLYIAK--NHSIDLHTL 238
58579356  161 GESLIEKISNDVLKIIYHQDIIGVQIGAALKNIIAIACGIIAGKnLGNNAVATVITKGMNEIKTLYIAK--NHSIDLHTL 238
225630494 236 LGPACLGDLIMTCTSLNSRNLSFGFKIGnsdNGFNVQQILSEGKSVIEGFSTAESIFNLAGKLKIKMPICEAVYRLLYES 315
190570996 235 LGPACLGDLVVTCTSLNSRNLSFGSKVAn-sNGSSAQQILSEGKSVIEGFNTAKSAFDLAEKLKIKMPICEAIYRLLYEN 313
88658270  239 IGPSCLGDLILTCTTAHSRNMSFGITIG---QGADINKMLNNNSKIIEGVSTVKPLISLAKELNIELPICTSIYNLLYKN 315
73667281  237 IGPSCLGDLILTCTTTHSRNMSFGVAIG---QGEDINKMLNKKSEIIEGVSTVKPLISLAEKLNIELPICTSIYNLLYKN 313
42520574  236 LGPACLGDLIMTCTSLNSRNLSFGFKIGnsdNGFNVQQILSEGKSVIEGFSTAESIFNLAGKLKIKMPICEAVYRLLYES 315
57239388  239 IGPSCLGDLILTCTTEHSRNMAFGLEIG---KGRNINTLIDHNLKLVEGTSTVKPLISLAKKLNVELPICISIYNLLHEN 315
58584854  236 LGPACLGDLIMTCTSLNSRNLSFGFKIGssnNSFDAQQTLSEGKSVIEGFSTAQSAFNLAEKLKIKMPICEAVYRLLYES 315
58617410  239 IGPSCLGDLILTCTTEHSRNMAFGLEIG---KGRNINTLIDHNLKLVEGTSTVKPLISLAKKLNVELPICISIYNLLHEN 315
58579356  239 IGPSCLGDLILTCTTEHSRNMAFGLEIG---KGRNINTLIDHNLKLVEGTSTVKPLISLAKKLNVELPICISIYNLLHEN 315
225630494 316 ASIEDTISVLIS 327
190570996 314 TSIEDTISVLVN 325
88658270  316 IPLEKTISDIL- 326
73667281  314 VSLDKTISEIL- 324
42520574  316 ASIEDTLSVLIS 327
57239388  316 ISLDKAISNILS 327
58584854  316 ASIEDTISVFVG 327
58617410  316 ISLDKAISNILS 327
58579356  316 ISLDKAISNILS 327
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap