Conserved Protein Domain Family
PRK14614

?
PRK14614: PRK14614 
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Statistics
?
PSSM-Id: 173078
View PSSM: PRK14614
Aligned: 9 rows
Threshold Bit Score: 499.276
Threshold Setting Gi: 39995766
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78224045    1 MKSLTLKAPAKVNYRLDVLRRRPDGYHDLRMIMQRIDLCDEITITLSDTSGVRVTCGREGVPDGPENIAWRAANALLALS 80 
39995766    1 MKKLTLKAPAKVNYRLDVLRRRPDGYHDLRMIMQRIDLCDEIEICLTDGPGIRVVCGREGVPDGPGNIAWRAADALLALS 80 
77919601    1 --MESFLAPAKINICLHVLGRREDGYHELAMLMQRVSLYDRISLSFIEGNDIRVQCDGLTLPLGQKNIAARAAQALFDRA 78 
148265703   1 MKKVKLKAPAKVNYRLDVLRRRPDGYHDLRMIMQRIDLCDDIEIALSGTRGVRVTCGRDGVPDGPDNIAWRAADALLTIS 80 
118579177   1 MKSLTLKAPAKVNYLLDVIRRRPDGYHDLRMVMQRVNLCDEIAIALTDSPELSVCCGKDGVPDGPGNIAWKAARAMLDLA 80 
189425652   2 LQSIILQAPAKVNYRLDVIARRPDGYHELRMIMQRVNLCDQVSIKLIDGNEIKVSCGREGVPDGEGNIAWKAARALLDLA 81 
197119148   1 MKKLQLLAPAKVNYRLDVLGKRPDGYHELRMIMQRVDLCDEIEIALSDSPGIRVTCGRKGVPDGPGNIAWRAADALLKLS 80 
222054662   1 MKTIECKAPAKVNYRLDVLRRRPDGYHDLRMIMQRIDLCDDIRISLSETPGVRVACGKEGVPDGPGNIAWRAADALLKLS 80 
253700072   1 MKKLQLLAPAKVNYRLDVLGKRPDGYHELRMIMQRVDLCDEIEIALTDVPGIRVTCGRKGVPDGPGNIAWRAADALLKLS 80 
78224045   81 GLETGIDIAITKNIPVAAGLGGGSSDAATVLLGVNELLGLGLSIERLMEVGVTLGADVPFFVFGKTALAEGIGEVLTAID 160
39995766   81 ADKPGIDISITKKIPVAAGLGGGSSDAATVLMGVNELLGLDLPEKRLREIGVTLGADVPFFIFGRTALAEGIGEELTAID 160
77919601   79 GIRRGLDIVIEKNIPVAAGLGGGSSDAATVLMGLNDMLGLGLSATQLMQEGVKLGADVPFFIYKHPAWATGIGDKLQEVE 158
148265703  81 GRAVGLDIAITKNIPVAAGLGGGSSDGATVLMGVNELLGLGFSDERLMEIGVKLGADVPFFIFKKTALAEGIGDKLTAVE 160
118579177  81 AGGQGATISIVKNIPVAAGLGGGSSDAATVLMGMNQLLELGLTDQELMRIGVKLGADVPFFIFKKTALAEGIGEQLRAMP 160
189425652  82 GQPSGVEIAIQKNIPVAAGLGGGSSDCAAVLLGLNELLGLGLSCEQLMEIGVKLGADVPFFVFQQTALAEGIGEKLTPLT 161
197119148  81 DKEVGIEITIAKKIPVGAGLGGGSSDAATVLMGVNELLELGLTDERLMEIGVKLGADVPFFVFKKPALAEGIGDRLTALE 160
222054662  81 GRCTGIDISIVKNIPVAAGLGGGSSDCASALMGVNELLELHLTDEQLMEAGSKLGADVPFFIFKKTALAEGIGDKLAAVE 160
253700072  81 GKEVGIDISIAKKIPVGAGLGGGSSDAATVLMGVNELLGLGLTDERLMEIGVKLGADVPFFIFKKPALAEGIGDRLTALE 160
78224045  161 AVPPLWLVIVNPNIPVSTAWVYQSLRLTGEWNGDTIPRFFKDVADVCAVLANDLELVTIERYPVIGEIKERLVAAGAAGA 240
39995766  161 RVPAAWIVVVNPNVPVSTAWVYQNLQLTGEAARVKIPRFFESVAEVCAILSNDLESVTIPRYPVIGEIKRELLAAGALGS 240
77919601  159 GLPPVWYVLVNPGLEVSTAWVYQNLRLTSARDNLRIPRFSGTVDEVVELLHNDLETVTVERFPLIGEIKQQLLGLGARGA 238
148265703 161 TISPVWLVLVNPHLHVSTGWVYQNLRLTAMKDDDIIPRFYGKIEDVCAILANDLESVTIGRFPVIQEIKERLLRVGACGS 240
118579177 161 PMPALWVLLVNPGVHVSTAWVYKNLRLTSRGELAKLPQFFSTVEDVCSMLSNDLESVTIPAFPVIADIKRAMLAKGALGA 240
189425652 162 GLPPAWVVLVNPNLPVSTAWVYKNLQLTQRERLATIPDSFEDVASICRVLSNDLESVTIPAFPVISEIKDELIARGACCS 241
197119148 161 EVPSLWVVLVNPGIHVSTAWVYQNLRLTTPDPATIIPRSYSSLNEVCELLSNDLEPVTCGRFPLVSELKEVLLTAGARGS 240
222054662 161 A-APAWLVIVNPNLAVSTAWVYQNLQLTAGKDEYIIPRFYGSVSDICAILANDLEKVTIGRFPVINQIKQKLLQVGAAGS 239
253700072 161 EVPSLWVVLVNPGIHVSTAWVYQNLRLTTGNPITIIPRSYSSLDEVCALLSNDLEPVTCGRFPLVSEVKEVLLAAGARGS 240
78224045  241 LMSGSGPTVFGLFASEEEARGAAQsITNSSDWFVVAVRAL 280
39995766  241 LMSGSGPTVFALFEEEDAAVRAAE-MMRARSWFAAAVRTI 279
77919601  239 LMSGSGSTVFGVFSDGDTARAAAEnLSSRSGWRAFAVEPV 278
148265703 241 LMSGSGSTVFGLFKDEAAARRAAEtLAAESNWFVVAVKTL 280
118579177 241 MMSGSGPTVFGLFRDREGAEAARAeLVEGSGWFAAVAETL 280
189425652 242 LMSGSGPTVFGLFDDEATARTAGEaLRGNNDWFVAVVETV 281
197119148 241 LMSGSGSTVFGLFESESAARHAAAeIAKARGWFAAAVRTI 280
222054662 240 LMSGSGSTVFGIFAEEAPARKAAEkLSRESDWFVAAVKTL 279
253700072 241 LMSGSGSTVFGLFDDENAARTAAAeIEKTRGWFAAAVRTI 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap