Conserved Protein Domain Family
PRK14613

?
PRK14613: PRK14613 
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Links
?
Statistics
?
PSSM-Id: 173077
View PSSM: PRK14613
Aligned: 6 rows
Threshold Bit Score: 515.218
Threshold Setting Gi: 189909800
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189909800   6 TIAHAKINIGLMIPYKREDGLHEIRSVFVPIDFGDpmEIQIKSLPKGIvsrFVFHSTNHLQGYRHSLFEAVSERGDLSQN 85 
183219663   6 TIAHAKINIGLMIPYKREDGLHEIRSVFVPIDFGDpmEIQIKSLPKGIvsrFVFHSTNHLQGYRHSLFEAVSERGDLSQN 85 
116332052   1 MISPAKINLGLEIPFKRPDGFHEIRSIFLKISWGD--DIEIEPADNGV---FELFSENEIILEKRKLYDQVSEIGDIKKN 75 
116327333   1 MISPAKINLGLEIPFKRPDGFHEIRSIFLKISWGD--DIEIEPADNGV---FELFSENEIILEKRKLYDQVSEIGDIKKN 75 
45656326    1 MISPAKINLGLEIPFKRLDGFHEIRSVFLKISWGD--DIEIEPASNGV---FELFSNNEIILEKRKLYDQVSERGDIKNN 75 
24216523    1 MISPAKINLGLEIPFKRLDGFHEIRSVFLKISWGD--DIEIEPASNGV---FELFSNNEIILEKRKLYDQVSERGDIKNN 75 
189909800  86 ILTKTFHKLKPYFQEALEIKVQIQKHLPPEGGIGGGSSNAGVLLQHLFPYTNLSRGEQIQ-FAKSIGADVPFFLQSSACF 164
183219663  86 ILTKTFHKLKPYFQEALEIKVQIQKHLPPEGGIGGGSSNAGVLLQHLFPYTNLSRGEQIQ-FAKSIGADVPFFLQSSACF 164
116332052  76 ILYKTFIKARSLFPELPGVKIHLTKRISPAGGLGGGSTNAASLLNFLFSWRSFFTSDEMRvFATEIGSDVPFFLGEGHAF 155
116327333  76 ILYKTFIKARSLFPELPGVKIHLTKRISPAGGLGGGSTNAASLLNFLFSWRSFFTSDEMRvFATEIGSDVPFFLGEGHAF 155
45656326   76 ILYKTFIKARSLFPELPGVKIHLTKRISPAGGLGGGSTNAASLLNFLFSWCPFFTSDEMFvLAAEIGSDVPFFLGEGHAF 155
24216523   76 ILYKTFIKARSLFPELPGVKIHLTKRISPAGGLGGGSTNAASLLNFLFSWRPFFTSDEMFvLAAEIGSDVPFFLGEGHAF 155
189909800 165 VTGIGEVMEPIRLAKGFGILAIPPFGLSTGSMYASLQKSLQKPYGSEVWKSLTEDLIRSLHVGDWVYLQNRLENEFEKIA 244
183219663 165 VTGIGEVMEPIRLAKGFGILAIPPFGLSTGSMYASLQKSLQKPYGSEVWKSLTEDLIRSLHVGDWVYLQNRLENEFEKIA 244
116332052 156 VTGKGEISEEIEVHPGQGILALTPQVMNTAEMYTLLKKPLQESASQKNGNTLSESLISVLKSGDWRSLQGRLLNDFEPVA 235
116327333 156 VTGKGEISEEIEVHPGQGILALTPQVMNTAEMYTLLKKPLQESASQKNGNTLSESLISVLKSGDWRSLQGRLLNDFEPVA 235
45656326  156 VTGKGEILEEIEVHHGQGILALTPQVMNTSEMYSLLKKPLQESASQKNGNTLSKNLISILKNGDWSSLQGRLWNDFEPVA 235
24216523  156 VTGKGEILEEIEVHHGQGILALTPQVMNTSEMYSLLKKPLQESASQKNGNTLSKNLISILKNGDWSSLQGRLWNDFEPVA 235
189909800 245 FQTQPLLKELKLGFFESGAIFASLSGSGSCLYGIYPTEEKRNEALPNVSLRFPKMEFRTFSF 306
183219663 245 FQTQPLLKELKLGFFESGAIFASLSGSGSCLYGIYPTEEKRNEALPNVSLRFPKMEFRTFSF 306
116332052 236 FQLHPELGVLKDKFLEFGSSYCSLTGSGSSMYGLVQGLEIQEELLHRLRQEFSNLTFVRFNF 297
116327333 236 FQLHPELGVLKDKFLEFGSSYCSLTGSGSSMYGLVQGLEIQEELLHRLRQEFSNLTFVRFNF 297
45656326  236 FQLHPELGVLKDKFLEFGSSYCSLTGSGSSMYGLVQGLEIQEELLQRLRQEFSNLTFVRFNF 297
24216523  236 FQLHPELGVLKDKFLEFGSSYCSLTGSGSSMYGLVQGLEIQEELLQRLRQEFSNLTFVRFNF 297
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap