Conserved Protein Domain Family
ruvA

?
PRK14602: ruvA 
Holliday junction branch migration protein RuvA
Statistics
?
PSSM-Id: 173066
View PSSM: PRK14602
Aligned: 10 rows
Threshold Bit Score: 286.222
Threshold Setting Gi: 256831252
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
220904537   1 MIAYLEGRLAETWGNTCLLITENGVGYAVALPAHTLSVLPGRGEHLALYTSLAVREDALELFGFATFEERQTFEVLISIS 80 
218888287   1 MIAYVEGRVAEISGNACVVVTEGGVGYEVHLPAHTLSRLPERGGQVAFHVRTEVREDALELFGFSTWDERQTFMVLTTIS 80 
120602036   1 MIAYVEGRLAEVAGNACVVVTDGGVGYEVFVPGHTLARLPDKGGRVSFFISTEVREDALELYGFATWDERQTFIVLTSIS 80 
78357366    1 MIAYIEGRVAEVTEQSCVVVTQGGVGYEVHLPSHLLARLPEQGAAVSFYIHTVVREDALELYGFSGWDERQTFLVLISIS 80 
94987628    1 MIAYLEGYIAEFGETSCVVATSSGIGYEVFLTTPTRSTLPNKGEQVRFYICHIVREDIQELFGFETWDERQTFIVLTSIS 80 
46580661    1 MIAYVEGRLAEVAGNACVVVTDGGVGYEVFVPGHTLARLPDKGGRVSFFISTEVREDALELYGFATWDERQTFIVLTSIS 80 
239907719   1 MIGYLEGRVVARRDRFAIVLTPGGVGYELELPTPVAAALPAPGGQVSLFVHTVVREDALELFGFASLDDRETFRTLIGIS 80 
242280346   1 MIAYIHGKLLEATDKSCIILTPGGVGYELFLTLSAISTLPESGSDVTFYVHSVIREDAFDLYGFPCFDDREVFRTLISVD 80 
256831252   1 MIAYLEGTVLRRDEESCVLLTAGGVGYQLHLTSDGLAALPGAGDTARLFVHTLVREDALTLFAFSSWEERQAFVTLLGAP 80 
258405866   1 MIGYLKGDVLRIRKDHCLLATAGGVGYDVQATAGTLGRL-EQGSEAELFVHTVVREDALELYGFASLAERDVFAELLGVS 79 
220904537  81 KVGARTALSILSIYRPEDLRRIVFEEDVMALTRVSGIGKKTAQHVFLELKYKLKV-DDVPQAAVLAStGERPG--SVFRD 157
218888287  81 KVGARTALAILSQFRPDDLRRLVVEDDVLALTRVSGIGKKTAQHIFLELKYKLKV-EDLPAGLVLAG-GAAPG--GVFRD 156
120602036  81 KVGAKTGLAILSQFRPDDLRRLVVEDDVLALTRVSGIGKKTAQHIFLELKYKLKV-EDLPAAAPLVT-GGAPG--GVFRD 156
78357366   81 KVGAKTALAVLSLYRPDDLRRIVADDDVTALTRVSGIGKKSAQHILLELKYKLKV-ESLPASAGLAA--GVPG--SVLRD 155
94987628   81 KVGARTALNMLSTFRPNDLRQCVIEEDIFALTRVSGIGKKTAQHIFLELKYKLQI-DGNSTTSSSPSiGQ-----SLFYD 154
46580661   81 KVGAKTGLAILSQFRPDDLRRLVVEDDVLALTRVSGIGKKTAQHIFLELKYKLKV-EDLPAAAPLVT-GGAPG--GVFRD 156
239907719  81 KLGPRTALAILSHFTADDLLRVVASGDAEALVRVPGIGKKSAQRIFIELSYKL---EGRAPAAGLAPsVPIPG--GVAGD 155
242280346  81 RLGPKKALAILSQFGPKDLQDLVFREDVKTLSIVPGIGPKSARQILWSLKDKM---ETLKSATVRSGaCPVEGdrSEFLD 157
256831252  81 KLGPKTALAMLGCYSPAELAACIAKEDVAALSRVPGIGAKTAKRLLLDLKDKLVS-----SPSLLPGrTAPAP--TASAD 153
258405866  80 KLGPKTSLAILSTFTPEELARIAQTEDTAALTRVSGIGPKSAKRIMWELKDKLTAwEGEAVPGTPQAtPASGG--SVFGD 157
220904537 158 VLDGLANLGYAEDECAPMVKKLLHEEPDLDVTGALRAALKALARGR 203
218888287 157 ALAGLGNLGYLEDEAAPVLKEVLKAEPDLDVAGALRAALKALARGR 202
120602036 157 ALAGLANLGYGEEEASHVLKEVLHGEPDLDVGGALRAALRALARGR 202
78357366  156 AVQALGNLGYAEEEAAPVLKNILKQDPDLDVSEALRAALKALAKAR 201
94987628  155 ILTGLQGLGYTKEESSVVIKSVLQHEPDLDVGSALRRCLKQLVKG- 199
46580661  157 ALAGLANLGYGEEEASHVLKDVLHGEPDLDVGGALRAALRALARGR 202
239907719 156 VVAGLTNLGYPEPEARQVAAEVLEAEPDLDVAAALRQALKRLASAK 201
242280346 158 ALSGLRNLGYGDDEVRDFLKDIFDEEPDLDAGGAIRVALKKISQNK 203
256831252 154 CAAALVSLGYGRHEVDEVVRVVFEKEPDLDAGSAIRQALKIFASK- 198
258405866 158 ALSGLCGLGYSEEEVRPVLSEILEQEPDLDVGEIIRACLKRLARHT 203
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap