Conserved Protein Domain Family
ruvA

?
PRK14601: ruvA 
Holliday junction branch migration protein RuvA
Statistics
?
PSSM-Id: 173065
View PSSM: PRK14601
Aligned: 10 rows
Threshold Bit Score: 308.295
Threshold Setting Gi: 222823639
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118475489   1 MIKAIEGIITKKEPTNVWIKTLSGVSYGISISLFTSASLQKGEKVELFITQVIREDANLLYGFIKESEQRIFEMLLKVNG 80 
57237644    1 MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKFYGFLDKDEQKMFEMLLKVNG 80 
121613230   1 MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKFYGFLDKDEQKMFEMLLKVNG 80 
157164589   1 MIKAIEGVVTKKEPAFAVLKTNSGVSYGIFISLFCSAKLSKGEKVELAITQIIREDANLLYGFLDANEQKMFEMLIKLNG 80 
157415070   1 MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKFYGFLDKDEQKMFEMLLKVNG 80 
154148334   1 MIVAVEGIITKKEPTFCVLKTVTGVSYGISISLGCSARINKGEKIELLTAQILREDADLLYGFLDEKEKRMFEMLIKLNG 80 
154174555   1 MIRAIEGIITKKEPAFVVLKTAGGVSYGLFISLFCSAKLSKGEKVELNTTQIIREDANLLYGFLDTNEQKMFEMLIKLNG 80 
153952036   1 MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKFYGFLDKDEQKMFEMLLKVNG 80 
222823639   1 MIVAIEGIVSKKEPTFVVLKTSSGVSYGVYVSLFCSGNFEKDQKIELSITQIIKEDSHKLYGFLDTNEQRMFELLIKISG 80 
218562427   1 MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKFYGFLDKDEQKMFEMLLKVNG 80 
118475489  81 IGASTAMAVCSSLGPDEFSIAVMNGDDAVLRRVPGIGPKTARTLIAQLSDAKfGEINSMPSYQNEAFMALESLGFKRDRI 160
57237644   81 VGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKSAKRIIVELSDTK-TKLENVSDDKSEALAALLTLGFKQEKI 159
121613230  81 VGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKSAKRIIVELSDTK-TKLENVSDDKSEALAALLTLGFKQEKI 159
157164589  81 IGASTAMAVCSSLSSQAFTNAIISGDADTFKSVPGIGPKTARRIIAELSDTKlISDESVPSYQNEALLALEALGFKREKI 160
157415070  81 VGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKSAKRIIVELSDTK-TKLENVSDDKSEALAALLTLGFKQEKI 159
154148334  81 IGANTAMAVCSSLSSDNFLRAIINGDTATLTTVPGIGPKTARRIIAELSDAKiELANDGEQYKIETISALENLGFKRDKI 160
154174555  81 IGASTAMAICSSLSPNAFSNAVINGDADTFKSVPGIGPKTARRIIAELSDAKlISDESVPGYQNEALLALEALGFKREKI 160
153952036  81 VGANTAMAVCSSLDINSFYKALSLGDESVLKKVPGIGPKSAKRIIVELSDTR-TKLENVSDDKSEALAALLTLGFKQEKI 159
222823639  81 IGATTAMALCSSLDTNTFYTALQSGDESVFKKVPGIGPKSAKRIIAELSDAK-INIENSNQDHAQALAALLSLGFKQENI 159
218562427  81 VGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKSAKRIIVELSDTK-TKLENVSDDKSEALAALLTLGFKQEKI 159
118475489 161 SKVLNECSSNDTASLIKEALKKLA 184
57237644  160 ISVLASAQATGTSELIKEALKKLG 183
121613230 160 ISVLASAQATGTSELIKEALKKLG 183
157164589 161 VKILPDCKSENTSDLIKEALKKLG 184
157415070 160 ISVLASAQATGTSELIKEALKKLG 183
154148334 161 NKILLNCKSTNTADLIKEALKKLA 184
154174555 161 VKILPDLKSTSTSELVKEALKKLA 184
153952036 160 ISVLASAQATGTSELIKEALKKLR 183
222823639 160 LKVLRTCESQNTSELIKEALKKLA 183
218562427 160 ISVLVSAQATGTSELIKEALKKLG 183
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap