Conserved Protein Domain Family
ruvA

?
PRK14600: ruvA 
Holliday junction branch migration protein RuvA
Statistics
?
PSSM-Id: 173064
View PSSM: PRK14600
Aligned: 13 rows
Threshold Bit Score: 282.792
Threshold Setting Gi: 73667297
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190571380   1 MIGNLRGIVDEV-CSDHIILNVNDVGYIVYLSAKTLSACSIGSRVKLLIDTYANsRENVTQLYGFISKEEQQCLRLLVKV 79 
222474859   1 MIGTLSGTVEEVvCSNRIILCVGGVGYLVQLPGRVLSGCQHGDHVRLYIETYVG-RDGVSQLYGFANREEQNCMRMLIKV 79 
225630965   1 MIGNLSGIVDEV-RSDHIILNVNDVGYMVYLSAKTLSACAIGSRIKLLIETYANnRENTTQLYGFISEEEQQCLRLLVKV 79 
88658340    1 MIGSLTGIIEEI-YNNYIILNVGNVGYIIYVSHKVLQSCKTGNNIKLYIETYVN-RDNLTQLYGFLDKQEQDYMRMLVTI 78 
88607371    1 MIGTLSGIIEEV-QDTSIILAVGGVGYIVHVSYRTLINCKRGDSIKLYIETYVN-RDNVPQLYGFTDTEEQNCLKMLIKV 78 
73667297    1 MIGSLTGIIEEI-YITYIILNVGNVGYIVHVSQRVLQTCKIGNNIKLYIETHVN-RDNLTQLYGFLDKQEQDYMRMLITI 78 
42520918    1 MIGNLSGIVDEV-RSDHIILNVNDVGYMVYLSAKTLNACSIGSRVKLLIETYANnRENVAQLYGFISKEEQQCLRLLVKV 79 
56416490    1 MIGTLSGTVEEVvCSNRIILCVGGVGYLVQLPGRVLSGCQHGDHVRLYIETYVG-RDGVSQLYGFANREEQNCMRMLIKV 79 
57239403    1 MIGSITGNVEEI-RDSYIILNVGNIGYIIYVSHKVLQTCKVGDNIKLYIETYVN-RDNITQLYGFLNRQEQDYLKMLVTI 78 
58617428    1 MIGSITGNVEEI-RDSYIILNVGNIGYIIYVSHKVLQTCKVGDNIKLYIETYVN-RDNITQLYGFLNRQEQDYFKMLVTI 78 
58584509    1 MIGNLSGTVDEV-YGDHIILNVNDVGYIIYLSAKALNVCYIGSKIKLLIETCANnRENTTQLYGFINKEEQSCLRLLVKV 79 
58579373    1 MIGSITGNVEEI-RDSYIILNVGNIGYIIYVSHKVLQTCKVGDNIKLYIETYVN-RDNITQLYGFLNRQEQDYLKMLVTI 78 
269959097   1 MIGTLSGTVEEVvCSNRIILCVGGVGYLVQLPGRVLSGCQHGDHVRLYIETYVG-RDGVSQLYGFANREEQNCMRMLIKV 79 
190571380  80 SGVSYKTAMSILSKLTPEQLFLAIINEDKLALKVSGLGLKLINRIITELNGKVSKLEINNNH---FHSISEDALSALINL 156
222474859  80 SGVNYKTAMAILDVLTPEQVFSAIVSEDRAALKVGGVGEKLISRIISELTPQVQKFELNRFAa--TTRTDSEAVAALLSL 157
225630965  80 SGVSYKTAMSILSKLTPEQLFLAIMNEDKVTLKMSGLGLKLINRIITELSGKVSKLEINNNN---FHPINEDALSALINL 156
88658340   79 NGINHKTAISILSKLSPEQIFSAVVSNNKNAFRGNGIGEKLAGRITTELQYKISKMPIEETL----IIKEDDSLAALISL 154
88607371   79 SGINYRTALAILDRLTPDQLFSAIVNEDKAALKVGGVGAKLINRIFTELTPLVQKLEFNIMDkrgPSVEDSDALSALLSL 158
73667297   79 NGINYKTAMSILSKLSPEQIFSAVVSNNKNAFRGNGIGEKLAGRITTELQYKISKMPIEETL----IIKEDDSLAALISL 154
42520918   80 SGVSYKTAMSILGKLTPEQLFLAIMNEDKVALKMSGLGLKLINRIITELSGKVSKLEINNNN---FHPINEDALSALINL 156
56416490   80 SGVNYKTAMAILDVLTPEQVFSAIVSEDRAALKVGGVGEKLISRIISELTPQVQKFELNRFAa--TTRTDSEAVAALLSL 157
57239403   79 NGINYKTALSILSKLSPEQIFSAVVNNDKIAFKGNGIGEKLAGRIITELQYKINKMPIEETF---SIIENDDSLAALISL 155
58617428   79 NGINYKTALSILSKLSPEQIFSAVVNNDKIAFKGNGIGEKLAGRIITELQYKINKMPIEETF---SIIENDDSLAALISL 155
58584509   80 SGVSYKTAMSILSKLTPEQLFLAIMNEDKIALKISGLGPKLINRIITELSGKVSKLETNNNN---FYPINEDAVSALINL 156
58579373   79 NGINYKTALSILSKLSPEQIFSAVVNNDKIAFKGNGIGEKLAGRIITELQYKINKMPIEETF---SIIENDDSLAALISL 155
269959097  80 SGVNYKTAMAILDVLTPEQVFSAIVSEDRAALKVGGVGEKLISRIISELTPQVQKFELNRFAa--TTRTDSEAVAALLSL 157
190571380 157 GYERTKAYDTIKKIEdesPNLDTKDIIRMALKTI 190
222474859 158 GYERTAALGALQKVG---VCDSTEDAVRRALLEL 188
225630965 157 GYEKMKAYDTIKKYR---PNLDTKDIIRMALKEL 187
88658340  155 GYDKLKAFNAIQEIKanfPDDSIQEIIRKALQKL 188
88607371  159 GYEKTRVLNALEKVG---VSHNLSDTVRFALKEL 189
73667297  155 GYDKLKAFNAIQEIKsdfPNANIQEIIRKALQKL 188
42520918  157 GYEKMKAYDTIKKYR---PNLDTKDIIRMALKEL 187
56416490  158 GYERTAALGALQKVG---VCDSTEDAVRRALLEL 188
57239403  156 GYEKLKAFNVIQEIKsktPDASTQEVIRKALQKL 189
58617428  156 GYEKLKAFNVIQEIKsktPDASTQEVIRKALQKL 189
58584509  157 GYEKTKVYDTIKKYK---PNLDTKDIIRTALKEL 187
58579373  156 GYEKLKAFNVIQEIKsktPDASTQEVIRKALQKL 189
269959097 158 GYERTAALGALQKVG---VCDSTEDAVRRALLEL 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap