Conserved Protein Domain Family
trmD

?
PRK14599: trmD 
tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Provisional
Links
?
Statistics
?
PSSM-Id: 173063
View PSSM: PRK14599
Aligned: 6 rows
Threshold Bit Score: 438.978
Threshold Setting Gi: 189911144
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
24215088    1 MKFNFITLFPDKIQSYFSEGLQQKAIESGVFSVNIIQLRNFSGNKHNRVDDTIYGGGPGMLLRVEPIHKAILSLGEEKGI 80 
45657431    1 MKFNFITLFPDKIQSYFSEGLQQKAIESGVFSVNIIQLRNFSGNKHNRVDDTIYGGGPGMLLRVEPIHKAILSLGEEKGI 80 
116328320   1 MKFNFITLFPEKIQSYFSEGLQQKAIESGIFSINTIQLRDFSGNKHNRVDDTIYGGGPGMLLRVEPIHKALLSLGENKGI 80 
116331046   1 MKFNFITLFPEKIQSYFSEGLQQKAIESGIFSINTIQLRDFSGNKHNRVDDTIYGGGPGMLLRVEPIHKALLSLGENKGI 80 
189911144   1 MRFNFITLFPEKITSYFDTGIPGKAVKQGVVEINPVHLRDFADNKHQKVDDTIYGGGPGMLLQVGPIYRALESLGDKKGK 80 
183221050   1 MRFNFITLFPEKITSYFDTGIPGKAVKQGVVEINPVHLRDFADNKHQKVDDTIYGGGPGMLLQVGPIYRALESLGDKKGK 80 
24215088   81 VILTSPSGIPFNQSIAMDLKKGGKPLTFISGYYEGVDHRVTEHLVDMEMSLGNYVLSAGDLASICIADAVSRLLPGFLGA 160
45657431   81 VILTSPSGIPFNQSIAMDLKKGGKPLTFISGYYEGVDHRVTEHLVDMEMSLGNYVLSAGDLASICIADAVSRLLPGFLGA 160
116328320  81 VILTSPSGIPFHQGIANKLKETGKPLTFISGYYEGVDHRVAEHLVDMEMSLGNYVISAGDLASICIADAVSRLLPGFLGA 160
116331046  81 VILTSPSGIPFHQGIANKLKETGKPLTFISGYYEGVDHRVAEHLVDMEMSLGNYVISAGDLASICIADAVSRLLPGFLGA 160
189911144  81 VILLSPSGELFNQTLAREIYESSDTFTLVSGYYEGVDHRVTEHLIDREVAIGNYVISSGDLAALVVADCLSRFVPGFLGK 160
183221050  81 VILLSPSGELFNQTLAREIYESSDTFTLVSGYYEGVDHRVTEHLIDREVAIGNYVISSGDLAALVVADCLSRFVPGFLGK 160
24215088  161 DESLLDESHNHPDILEYPQFTKPSEYNGWKVPDVLLSGNHASILAWREQNRKKIERGNYEST 222
45657431  161 DESLLDESHNHPDILEYPQFTKPSEYNGWKVPDVLLSGNHASILAWREQNRKKIERGNYEST 222
116328320 161 GESLLDESHNYPDVLEYPQFTKPSEYNGWKVPEVLLSGNHASILAWREQNRKKIDPDQERKL 222
116331046 161 GESLLDESHNYPDVLEYPQFTKPSEYNGWKVPEVLLSGNHASILAWREQNRKKIDPDQERKL 222
189911144 161 EESLLEESHNETEELEYPQYTKPYDFMGWTVPDVLLGGHHEEIRKWRQKNRKTRNHS----- 217
183221050 161 EESLLEESHNETEELEYPQYTKPYDFMGWTVPDVLLGGHHEEIRKWRQKNRKTRNHS----- 217
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap