Conserved Protein Domain Family
rimM

?
PRK14594: rimM 
16S rRNA-processing protein RimM; Provisional
Links
?
Statistics
?
PSSM-Id: 173058
View PSSM: PRK14594
Aligned: 8 rows
Threshold Bit Score: 258.944
Threshold Setting Gi: 203288128
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218249955   1 MFIKGVILSSYGVNGYARVKSISNNFCDFINLKNNKVLLKKSNSSSVEVKVVDVNIKGNSLFLKFEEIDTPEAVRPLIGF 80 
187918552   1 MFVKGIILSSYGINGYAKVKSISNNFNDFLDLKGSKLVLKKECCSSIEVKVEDVSLMNKSLLLKFEEFDAPEPIKDLIGF 80 
203284594   1 MFVKGIILSSYGINGYAKIKSISNGFSDFFCLKNSKLVLKKKFCCSVEVTVEDVSLRNNSLLLKFREFNAPEPIKNLIGF 80 
203288128   1 MFVKGIILSSYGINGYAKIKSISNGFSDFFCLKNSKLVLKKNFCCLVEVTVEDVSLRNNSLLLKFREFNAPEPIRNLIGF 80 
111115529   1 MFIKGVILSSYGVNGYARIKSISNNFCDFINLKNNKVLLKKSNGFAIEVKVIDVNIKSNSLFLKFEGIDAPESVKPLIGF 80 
119953474   1 MFVKGIILSSYGINGYAKVKSISNGFDDFFDLKGNKLVLKKKCCSSIEVKVEDVSLMNHSLLLKFEEFNTPELIKDLIGF 80 
15595042    1 MFIKGVILSSYGVNGYARVKSISNNFCDFINLKNNKVLLKKSNSSSVEVKVVDVNIKGNSLFLKFEEIDTPEAVRPLIGF 80 
51598951    1 MFIKGVILSSYGVNGYARVKSISNNFCDFINLKDNKVLLKKNNGFTIEVKVVDVNIKSNSLYLKFEGINTPESVKSLIGF 80 
218249955  81 ELWVDDSLASSLKEGEYYLGKLIGYAIVNNNKKLGEVVAFFEYLNSVFLEVRVGIKFFFIPFLSIYIGDINAQEKTIELK 160
187918552  81 ELWVNDEFASKLEEDEYYFGELIGYKLINNGQELGVVVSFYECVKSILLEVKVGSKLFFVPFLNVYLGDINRELKTIELK 160
203284594  81 ELWVSDELASKLEQDEYYFGKLIGYRVVNDGVELGIVVSFFECSKSVLLEIKVGDRLFFVPFLDVYLGDINRELKTIELK 160
203288128  81 ELWVSDELASKLEQDEYYFGKLIGYRVVNDGVELGIVVSFFECSKSVLLEIKVGDRLFFVPFLDVYLGDINRELKTIELK 160
111115529  81 ELWVDDSLASSLKEGEYYLGKLIGYTIVNDNRKLGEVVAFFEYLNNVFLEVKVGIKFFFIPFLSIYIGNIDAREKTIELK 160
119953474  81 ELWVNDEFASKLEEGEYYFGELIGYKLVNNGKELGVVVSFFECVASILLEVKVGSKLFFVPFLNIYLGDIDRELKTIELK 160
15595042   81 ELWVDDSLASSLKEGEYYLGKLIGYAIVNNNKKLGEVVAFFEYLNSVFLEVRVGIKFFFIPFLSIYIGDINTQEKTIELK 160
51598951   81 ELWVDDSLASSLKEGEYYLGKLIGYAIVNDNRRLGEVVSFFEYLNSVFLEVKVGIKFFFIPFLSIYIGDIDAREKTIELK 160
218249955 161 VLDLLK 166
187918552 161 VLDLLK 166
203284594 161 VLELLQ 166
203288128 161 VLELLQ 166
111115529 161 VLDLLR 166
119953474 161 VLDLLK 166
15595042  161 VLDLLK 166
51598951  161 VLDLLR 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap