Conserved Protein Domain Family
rimM

?
PRK14592: rimM 
16S rRNA-processing protein RimM; Provisional
Statistics
?
PSSM-Id: 173056
View PSSM: PRK14592
Aligned: 13 rows
Threshold Bit Score: 249.254
Threshold Setting Gi: 88658505
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190571183   1 MNICLGIITSPHGIKGAVKIKTFTEKPENIFLYGELISGSENYKISLVSVVSNNLVIATISGVNSRNEAELLRNKKLYIE 80 
222475615  24 DMVLLGVVRAPHGVMGLVKVRTFTEDPSHISAYGPLTDGHNCFNVTVVSVLGADSVIAKFDGLSSRTESEKLRGKRLYVS 103
225630985   4 NLVCLGIITSPHGIKGAVKVKTFTEKPENISLYGKLISGDENYKIDSVSVIGDNLVIATISGVNSRNEAELLRNKKLYIE 83 
88606853    6 TFILLGVIYAAHGVRGCVKIKTFTHDPSDIAAYGPLTDGSESLKVSVMSVIKNGCVIAKISGIDDRCSAEALKNKKLYVS 85 
88658505    4 DLICLGVITSSHGISGHVKIKTFTENPEDFTSYGTLTDGINTYEVEIISIISQNIIIAQIKGIVSRTDADLLRNKKFFVE 83 
73667543    4 DLICLGVITSSHGISGHVKIRTFTESPEDFTSYGMLTDGTNTYKISIVSVISQNIIIAKIKNIVSRNDADLLRNKKLFIE 83 
56417251   24 DMVLLGVVRAPHGVMGLVKVRTFTEDPSHISAYGPLTDGHNCFNVTVVSVLGADSVIAKFDGLSSRTESEKLRGKRLYVS 103
57239611    4 DFICLGIITSPHGIKGHVKIKTFTENPQNFTSYGKLTDGITTYEINIIQVVSKNTIIAKINNITSRTNAELLRNKKLFIE 83 
58579600    4 DFICLGIITSPHGIKGHVKIKTFTENPQNFTSYGKLTDGITTYEINIIQVVSKNTIIAKINNITSRTNAELLRNKKLFIE 83 
58584390    4 NLVCMGIITSPHGIKGAVKVKIFTEKPENISLYGKLISGSKNYDIDSVSVIGENLVIATINGVNSRNEAEFLRNKKLYVE 83 
58617654    4 DFICLGIITSPHGIKGHVKIKTFTENPQNFTSYGKLTDGITTYEINIIQVVSKNTIIAKINNITSRTNAELLRNKKLFIE 83 
42521077    4 NLVCLGIITSPHGIKGAVKVKTFTEKPENISLYGKLISGDENYKIDSVSVIGDNLVIATISGVNSRNEAELLRNKKLYIE 83 
269958359   5 DMVLLGVVRAPHGVMGLVKVRTFTEDPSHISAYGPLTDGHNCFNVTVVSVLGADSVIAKFDGLSSRTESEKLRGKRLYVS 84 
190571183  81 RNKLPQLNdEDEFYQNDLVNMEVRLESNELYGYVKSVHNFGSGDILEILvISTKKNIMLSFTKEIFPYINMKERYIVINM 160
222475615 104 RSSLPRLQ-EDEFYENELIGMDAKLEDGTAYGVISAILNFGSCDIIELS-TSTGKVVMVPFSRSTFPVVDVERRVVIVVP 181
225630985  84 RSKLPELNdEDEFYQSDLVDMEVRLKSNELYGYVKSVYNFGSGDILEILvISTKKRIMLSFTKEIFPHINIKGRYIVLNI 163
88606853   86 SSCLPKLK-NDEFYKDELIGLSVKLPDDTIFGIVTEVFNFGSGDIVEIS-TPQGKKEMFSFTSNIFPSIDMKTREMTIVP 163
88658505   84 KNKLPNPTnDDEFYYSDLIGLNVVLENNNVYGNIKKIHNFGSCDIIEIRlSNSKKSTMLPFTKDIFPYVNVKEKYIIITL 163
73667543   84 KDKLPNLTnNDEFYHNDLIGLNVILENNKVYGNIKKIHNFGSCDIIEIClSNSKKSTMLPFTKNIFPYINIKEKYIIINL 163
56417251  104 RSSLPRLQ-EDEFYENELIGMDAKLEDGTAYGVISAILNFGSCDIIELS-TSTGKVVMVPFSRSTFPVVDVERRVVIVVP 181
57239611   84 KTKLPNLI-ENEFYHSDLVGLQVILEDNNIFGTIKKIYNFGSCDIIEILlYNSKKSTMLPFSKDIFTHINTKERYVILKL 162
58579600   84 KTKLPNLI-ENEFYHSDLVGLQVILEDNNIFGTIKKIYNFGSCDIIEILlYNSKKSTMLPFSKDIFTHINTKERYVILKL 162
58584390   84 RNKLLKLNdENEFYQSDLVNMEIRLENDELYGYIKSIYNFGSGDILEISvISTKKNIMLPFTKEIFPYVNIKERYITLNM 163
58617654   84 KTKLPNLI-ENEFYHSDLVGLQVILEDNNIFGTIKKIYNFGSCDIIEILlYNSKKSTMLPFSKDIFTHINTKERYVILKL 162
42521077   84 RSKLPELNdEDEFYQSDLVDMEVRLKSNELYGYVKSVYNFGSGDILEILvISTKKRIMLSFTKEIFPHINIKGRYIVLNI 163
269958359  85 RSSLPRLQ-EDEFYENELIGMDAKLEDGTAYGVISAILNFGSCDIIELS-TSTGKVVMVPFSRSTFPVVDVERRVVIVVP 162
190571183 161 PEFIGQ 166
222475615 182 PEVIGV 187
225630985 164 PEFID- 168
88606853  164 PEIVGV 169
88658505  164 PEVIGN 169
73667543  164 PETIGN 169
56417251  182 PEVIGV 187
57239611  163 PEIIGS 168
58579600  163 PEIIGS 168
58584390  164 PEFIG- 168
58617654  163 PEIIGS 168
42521077  164 PEFID- 168
269958359 163 PEVIGV 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap