Conserved Protein Domain Family
rimM

?
PRK14591: rimM 
16S rRNA-processing protein RimM; Provisional
Statistics
?
PSSM-Id: 173055
View PSSM: PRK14591
Aligned: 9 rows
Threshold Bit Score: 336.627
Threshold Setting Gi: 134301360
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56707321    1 MSQDFVEIAKIGATYKLNGELNLYPLANSIETLLSYGDWYIQLPATNVWQQLKGESVLKRADKVYIKLANINNADTAKKY 80 
115315366   1 MSQDFVEIAKIGATYKLNGELNLYPLANSIETLLSYGDWYIQLPATNVWQQLKGESVLKRADKVYIKLANINNADTAKKY 80 
110669791   1 MSQDFVEIAKIGATYKLNGELNLYPLANSIETLLSYGDWYIQLPATNVWQQLKGESVLKRADKVYIKLANINNADTAKKY 80 
89257006    1 MSQDFVEIAKIGATYKLNGELNLYPLANSIETLLSYGDWYIQLPATNVWQQLKGESVLKRADKVYIKLANINNADTAKKY 80 
134301360   1 MSQDFVEIAKIGATYKLNGELNLYSLANSIETLLSYGDWYIQLPATNVWQQLKGESVLKRADKVYIKLANINNADTAKKY 80 
118498129   1 MSQDFVEIAKIGATYKLDGELNLYPLANSIETLISYGDWYIQLPATNVWQQLKGESVLKRADKVYIKLANINDADTAKKY 80 
156503206   1 MSQDFVEIAKIGATYKLNGELNLYPLANSIETLLSYGDWYIQLPATNVWQQLKGESVLKRADKVYIKLANINNADTAKKY 80 
187931090   1 MSQDFVEIAKIGATYKLNGELNLYPLANSIETLLSYGDWYIQLPATNVWQQLKGESVLKRADKVYIKLANINNADTAKKY 80 
167627276   1 MSQDFVEIAKIGATYKLDGELNLYPLASSIETLLSYGDWYIQLPANSAWQPLKDESVLRRADKLYIKLASVNDVETAKKY 80 
56707321   81 VNALIGVPKRALPQLAEDEVYFKDLIGCSVKNINNDSFGVVVDIIETDANEVLVCKEDNSEYLIPYVKQYIVSEDLNSKK 160
115315366  81 VNALIGVPKRALPQLAEDEVYFKDLIGCSVKNINNDSFGVVVDIIETGANEVLVCKEDNSEYLIPYVKQYIVSEDLNSKK 160
110669791  81 VNALIGVPKRALPQLAEDEVYFKDLIGCSVKNINNDSFGVVVDIIETDANEVLVCKEDNSEYLIPYVKQYIVSEDLNSKK 160
89257006   81 VNALIGVPKRALPQLAEDEVYFKDLIGCSVKNINNDSFGVVVDIIETGANEVLVCKEDNSEYLIPYVKQYIVSEDLNSKK 160
134301360  81 VNALIGVPKRALPQLAEDEVYFKDLIGCSVKNINNDSFGVVVDIIETGANEVLVCKEDNSEYLIPYVKQYIVSEDLNSKK 160
118498129  81 VNALIGVPKRALPQLAEDEVYFKDLIGCSVKNINNDSFGVVVDIIETGANEVLVCKEDNSEYLIPYVKQYIVSEDLNSKK 160
156503206  81 VNALIGVPKRALPQLAEDEVYFKDLIGCSVKNINNDSFGVVVDIIETGANEVLVCKEDNSEYLIPYVKQYIVSEDLNSKK 160
187931090  81 VNALIGVPKRALPQLAEDEVYFKDLIGCSVKNINNDSFGVVVDIIETGANGVLVCKEDNSEYLIPYVKQYIVSEDLNSKK 160
167627276  81 VNSLIGVPKEALPKVGNDEAYFTDLIGCTIVNTANDSFGKVIGIIETGANEVLVCKKDSDEYLIPYVKQYIVSEDLDLKK 160
56707321  161 IVVDWEYDY 169
115315366 161 IVVDWEYDY 169
110669791 161 IVVDWEYDY 169
89257006  161 IVVDWEYDY 169
134301360 161 IVVDWEYDY 169
118498129 161 IVVDWEYDY 169
156503206 161 IVVDWEYDY 169
187931090 161 IVVDWEYDY 169
167627276 161 IVVDWEYDY 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap