Conserved Protein Domain Family
rimM

?
PRK14590: rimM 
16S rRNA-processing protein RimM; Provisional
Links
?
Statistics
?
PSSM-Id: 173054
View PSSM: PRK14590
Aligned: 6 rows
Threshold Bit Score: 280.202
Threshold Setting Gi: 189911143
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
183221049   1 MKVGVFGSSHGIKGFIKVFTEGETLHTLKAPATCTV--EDPQGKTSTIAIEEFRPNGNHFLVKIKGYDTPETVVKYRGYS 78 
189911143   8 VKVGVFGSSHGIKGFIKVFTEGETLHTLKAPATCTV--EDPQGKTSTIAIEEFRPNGNHFLVKIKGYDTPETVVKYRGYS 85 
116331047   6 ISLGQLGKPFGIKGWLRFNVRDSILTKVKLPVRLKLgkSDPNFPETEIILLEIRPHNGKFVVRFEGIATPEEAEKWVGGI 85 
116328321   6 ISLGQLGKPFGIKGWLRFNVRDSILTKVKLPVRLKLgkSDPNFPETEIILLEIRPHNGKFVVRFEGIATPEEAEKWVGGI 85 
24215089    6 ISLGQLGKPFGIKGWLRLNVRETVLCELKTPISLKLskPDFHFPEKEITLLEIRPHGGKFIVRFEGVTTPEEAAKWIGGF 85 
45657430    6 ISLGQLGKPFGIKGWLRLNVRETVLCELKTPISLKLskPDFHFPEKEITLLEIRPHGGKFIVRFEGVTTPEEAAKWIGGF 85 
183221049  79 LLWKKEDLPK-PNEGEIYSEDLIGLLVIsKETKQPLNYKITQVMDNPAHPILECkpIQGEGETILVPFLNQFVGDWDLEN 157
189911143  86 LLWKKEDLPK-PNEGEIYSEDLIGLLVIsKETKQPLNYKITQVMDNPAHPILECkpIQGEGETILVPFLNQFVGDWDLEN 164
116331047  86 LFLPQNLLPKiETKDEFYVRDLIGLQAI-DEFGKSLNWKLTDIQDNPAHPILVF--SKSEEEEILIPFLHVFVGELNLEK 162
116328321  86 LFLPQNLLPKiETKDEFYVRDLIGLQAI-DEFGKSLNWKLTDIQDNPAHPILVF--SKSEEEEILIPFLHVFVGELNLEK 162
24215089   86 LFLPQKLLPKiETKNEFYITDLIGLQAI-DESGKKLDWKLKDVQDNPAHPILVF--VKENGEEILIPFLQVFVGDLDLEK 162
45657430   86 LFLPQKLLPKiETKNEFYITDLIGLQAI-DESGKKLDWKLKDVQDNPAHPILVF--VKENGEEILIPFLQVFVGDLDLEK 162
183221049 158 QTIECIHWEQWFAL 171
189911143 165 QTIECIHWEQWFAL 178
116331047 163 KTIVLIQPELWNEV 176
116328321 163 KTIVLIQPELWNEV 176
24215089  163 NTIVLIQPEIWNEI 176
45657430  163 NTIVLIQPEIWNEI 176
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap