Conserved Protein Domain Family
PRK14588

?
PRK14588: PRK14588 
tRNA pseudouridine(38-40) synthase TruA
Statistics
?
PSSM-Id: 173052
View PSSM: PRK14588
Aligned: 6 rows
Threshold Bit Score: 460.507
Threshold Setting Gi: 159901453
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163847952   1 MRTIALLLAYDGTDFAGSQWQTDIRTVQGALESAWEALTQERRRIVLAGRTDAGVHATGQVAHVQTTTRHNLQTIWRGLN 80 
159901453   2 SRTLALCFEYLGTAFCGSQWQPGGRAVQTELETAWQRLTSETGRWIFAGRTDAGVHALAQVAHIVSDTPRSLDTIAKAIN 81 
219849858   1 MRTIALLLAYDGTDFAGSQWQTDIRTVQGAIEAAWEALTQEQRRIVLAGRTDAGVHASGQVAHVQTATRHSLATIWRGLN 80 
222525832   1 MRTIALLLAYDGTDFAGSQWQTDIRTVQGALESAWEALTQERRRIVLAGRTDAGVHATGQVAHVQTTTRHNLQTIWRGLN 80 
148655308   1 MRNIALRIEYDGADFVGSQWQTNGRSVQGVLEAAWQQLTGERRRMTLAGRTDAGVHARGQVANVRTDTRHTISTIVRGLN 80 
156743919   1 MRNIALRIEYDGTDFVGSQWQTNGRSVQGALEAAWQQLTGERRRMILAGRTDAGVHARGQVANVSTNTRHSLATIIRGLN 80 
163847952  81 AHLPVDLAIQNVGEAVPDFHARFSAIQREYRYLIDCAAAPLPQLRHQVLHYAGTLDVAAMTAALKLLEGTHDFAAFTTAt 160
159901453  82 AITPPDISVHEAWEMPTGFHARFSARQRTYRYVFDSAPAPSATLSGRVLRLDHQLDWAAMQAALDTLIGTHDFAAFAGA- 160
219849858  81 AHLPTDVTVQNVGEAVRDFHARYSAIEREYRYLIDCAPVPLPQLRHQALHYAGTLDVTAMATALKLLEGTHDFAAFTTAt 160
222525832  81 AHLPVDLAIQNVGEAVPDFHARFSAIQREYRYLIDCAAAPLPQLRHQVLHYAGTLDVAAMTAALKLLEGTHDFAAFTTAt 160
148655308  81 GILPEDVGVLAAWEAPDDFHARYSAVRREYRYVIDNGRTPSPLLRRHAAYVPRRLDTAAMDAVVRQVIGTHDFAPLSDG- 159
156743919  81 GVLPEDIGILAAWEVPEEFHARYSAVRREYRYVIDNGRTPSPLLRRHAAYVPRRLDVAAMDRAIQQVIGTHDFAPLSDG- 159
163847952 161 PAQRSTVRTMYWTRVGDYEWFERRLLAIEVAANAFLQHMVRMIVGTLLLVGRGRMTVDQFGEVLASRDRRLAGPTAPAHG 240
159901453 161 GHEGSTTRTCMLAQLRPAEWLGRPVTVLHLQANAFLKHMVRNIVGTLLMVGDGRLSLEAWQAIIASRDRRNAGPTAPPQG 240
219849858 161 PSQRSTVRTMYWTRIVERVWFDRRLLAIELAANAFLQHMVRMIVGTLLLVGRGRMTVDQFGEVLAGRDRRLAGPTAPAHG 240
222525832 161 PAQRSTVRTMYWTRVGDYEWFERRLLAIEVAANAFLQHMVRMIVGTLLLVGRGRMTVDQFGEVLASRDRRLAGPTAPAHG 240
148655308 160 PQEGSTVRICYEARCTRTEVWGQPLVLIDIAANAFLRHMVRNLVGTLIQVGEGRIDADRFAAVLAGDDRR-ARVLAPAHG 238
156743919 160 PQEGSTVRICYDARCTCTEVWGQPLVLIDVAANAFLRHMVRNLVGTLIQVGEGRIDADGFAAVLAGANRR-ARVLAPAHG 238
163847952 241 LTLTAVRYPPGLiRWVEPSKRQNGTTKVEQPSS 273
159901453 241 LYLESIGYDPAL-QPLATSSRWDGTTYFRTYQG 272
219849858 241 LTLTAVRYPPGLiRWVEPLERQQGATKVEQPSS 273
222525832 241 LTLTAVRYPPGLiRWVEPSKRQNGTTKVEQPSS 273
148655308 239 LYLMAVRYPEDGtGAADEPAAPHGVTETRMQL- 270
156743919 239 LYLMAVRYPEDGnAAADTLVAAVGVTETRMQL- 270
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap