Conserved Protein Domain Family
PRK14587

?
PRK14587: PRK14587 
tRNA pseudouridine synthase ACD; Provisional
Statistics
?
PSSM-Id: 173051
View PSSM: PRK14587
Aligned: 5 rows
Threshold Bit Score: 437.722
Threshold Setting Gi: 126459314
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18312431    1 MPYLYRIAYDGTMFYGFTGHPNSLEPRLRLIFGEILGRGSRTDPGVSAVGNVVMTGRKMALGYVNSKMPKGAWAWGIAEV 80 
145590498   1 MPYLYRIAYDGTLFYGFTGHPNSLEPKLRAALGEILGRGSRTDPGVSAVANVVMTSQRLHLGYVNSKLPRGVWAWGVAEV 80 
126459314   1 MPYLYRVAYDGALFHGFTGHSNSVEAALRRVFGHLLGRGSRTDPGVSAVGNAVLAPSRLPLGYINSRLPRGVWTWAVAEV 80 
119872780   1 MPYLYRIAYDGTLFYGFTGHSRSLEPALKRVFGEILGRGSRTDPGVSAVANTVMVSQKLPIALVNSKLPRGVWAWAIAEV 80 
171184695   1 MPYLYRIAYDGTLFYGFTGHPRSLEPHLRRALGDVLGRGSRTDPGVSAVGNVVMTSAKVQPAAANSKLPRGVWVWAAAEV 80 
18312431   81 PEGFNPRRAKLRRYLYVAPHWGEDVDVMREAAKLLTGTHDYSSFIQLRGEKHTPTVTTVYDIDVTLRGDLIFIYFAGRGF 160
145590498  81 PEGFNPRRAKARRYLYVAPHWGEDVEAMREAAAVLVGTHDYSSFIKRRGDKATPTVTTVYKIEVEQRGGLIYMMFVGRGF 160
126459314  81 GEGFNPRRARRRRYLYVAPHWGEDVEAMREVAELFKGTHDFSSFIQFRGERGTPPVTTVDEVGVEVAGRLVYLYFVGKGF 160
119872780  81 PQSFNPRRAKFRHYLYVAPHWGEDLGSMHEAAEVLAGTHDFASFIQRRGEKIS-TIATVMEIKVELRGDLIYMHFVGRGF 159
171184695  81 PEGFNPRRARSRHYLYVAPHWGEDLDSMREAAELLAGTHDYASFVQRRGEPAS-TVTTIFSITVETRGDLVFLHFVGRGF 159
18312431  161 RNKMIRKMAWALLAAGRGVLSVDDLADLLKKPRPGAVPSAPAEGLVLLDIVYDVKFEVDFSALRKAYVYFLSKSRHLSAH 240
145590498 161 RNKMIRKMAWAILATGRGVLKASDLRELVERPRPGAVPSAPAEGLVLLDIDYGIEFEVYHTALREAYTYFLRKYRAVEAH 240
126459314 161 RNKQIRKMAWAILAAGRGVVSRRYVEELLERPRPGAVPSAPAEGLILLDIEYDVKFDVDRGELRKAYVYFLEKYRRLEAL 240
119872780 160 KNKMIRKLAWAILAAGRGIFNIRDIRELLERPRPGVVPSAPAEGLVLLNIEYDVDFQIDYTALRSAYVYFLSKYRHAVAH 239
171184695 160 RNKMIRKLAWAILAAGRGVLRKRDIADLLERPKPGAVPSAPAEGLVLLDIDYGVEFQVDYPSLRKAYRYFLWRYRYAAAH 239
18312431  241 AAALRAAGEALAMWES 256
145590498 241 AAALKAAGEALARLDV 256
126459314 241 AAAYRAAGERLLFYDD 256
119872780 240 AAALKAVGETLATWEQ 255
171184695 240 AAVFKAAGEALAAWEE 255
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap