Conserved Protein Domain Family
PRK14586

?
PRK14586: PRK14586 
tRNA pseudouridine(38-40) synthase TruA
Statistics
?
PSSM-Id: 173050
View PSSM: PRK14586
Aligned: 11 rows
Threshold Bit Score: 453.85
Threshold Setting Gi: 160903290
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154249373   1 MRRVAIEFSYDGTDFFGYQIQNNVRTVQGELEKALEKVFKIHIDTYAAGRTDTGVHANGQVVSFDCPNDRLMENDIKNAI 80 
217077259   1 MKRFAIEFAYDGTKFFGYQGQPNVRTVQGDLEDALERIFKERIYTQAAGRTDAGVHANGQVAAFNCPIERLTETDIKNAL 80 
170289026   1 MKRVAAVIEYDGSNFFGYQGQPDVRTVQGVIEDALERIFKQRIYTQAAGRTDAGVHANGQLIAFNCPNDRMTTEDIKNAM 80 
160903290   1 MKWVAATVMYDGSNFYGYQSQPTFRTVQDEFEKALKVIFKKEIPSYACGRTDTGVHAVGQVISFKVENENMTEKNIKDAL 80 
222100131   1 MRRVAAIVEYDGSNFFGYQGQPDVRTVQGVIEDALERIFKQRIYTQAAGRTDAGVHANGQLIAFNCPNDRMTTEDIKNAM 80 
157363557   1 MKRFMAIVSYDGTNFCGFQVQKDVRTVQGMFEQALERILKQRVITIAAGRTDTGVHANGQIVCFDCYLD-IDEESMKNAM 79 
150020829   1 MKRFAIEFSYDGTNFFGYQGQPNVRTVQGELEKALERIFKERIFTQGAGRTDAGVHANGQVAAFNCPIDRLAAIDIKNAL 80 
148270348   1 MKRVAAVIEYDGSNFFGYQGQPDVRTVQGVIEDALERIFKQRIYIQAAGRTDTGVHANGQLIAFNCPNDRMTTEDIRNAM 80 
15644322    1 MKRVAAVIEYDGSNFFGYQGQPDVRTVQGVIEDALERIFKQRIYTQAAGRTDTGVHANGQLIAFNCPNDRMTTEDIRNAM 80 
239618279   1 MKRFAAVVVYDGSNFFGYQIQPNKRTVQGVFEEALERIHKAKIPTDGAGRTDTGVHAYGQVIAFTSNLDRLTPKHMKDAL 80 
281412654   1 MKRVAAVIEYDGSNFFGYQGQPDVRTVQGVIEDALERIFKQRIYTQAAGRTDAGVHANGQLIAFNCPNDRMTTEDIKNAM 80 
154249373  81 NANLPGDIYIKKVWFTHPTFNPRYEAKRRIYHYYIdTSKSKNLFTRRYVWWFPYELDIEKMRIAAKYLIGEHDFISFsKK 160
217077259  81 NANLPDDIYVKKAWVVDKSFNPRFAATKRIYHYFI-STNEKDVFMRNYVWNFRYDLDIEAMRKAASFLEGEHDFSSF-KK 158
170289026  81 NANLPDDVYVKEVFEVSKNFHPRFDVKKRIYHYFIlTSKQKNVFLRKYVWWFPYELDLDAMRKAAKYLEGTHDFTSF-KT 159
160903290  81 NAILPEDVYVKEVKEVKEGFNPRAEAKKRIYHYFIyISEDPNIFLRDRVWWIPFALNLEKMRQAAKYFEGEHDFTSF-KT 159
222100131  81 NANLPDDVYVKKVFEVPKNFHPRFDVKKRIYHYFIhTSREKNVFLRKYAWWFPYELDLEAMRKAAKYLEGTHDFTSF-KT 159
157363557  80 NANLPDDIYVRKVVEVDKNFHPRFDAKRRIYHYLIyNSQEPNLFIRNYAWWFPYKLNICKMREAAKFFEGEHDFRSFmKS 159
150020829  81 NANLPEDIYVKKAWEVEKNFNPRFRAKKRIYHYLV-STNEKDVFKRNYVWHFKYKLNIEAMRIAARYLEGEHDFSSF-KK 158
148270348  81 NANLPDDVYVKEVFEVPVNFHPRFDVTKRIYHYFIlTSRQKNVFLRKYVWWFPYELDLDAMRKAVKYLEGTHDFTSF-KT 159
15644322   81 NANLPDDVYVKEVFEVPVNFHPRFDVTKRIYHYFIlTSRQKNVFLRKYVWWFPYELDLDAMRKAVKYLEGTHDFTSF-KT 159
239618279  81 NANLPDDIYVRRIHEVPSNFSPRFAAKKRIYHYYIlNTKEPDLFRRKYFWWFPYEVDLNRMRQASRYLIGEHDFTSF-RT 159
281412654  81 NANLPDDVYVKEVFEVPVNFHPRFDVTKRIYHYFIlTSRQKNVFLRKYVWWFPYELDLDAMRKAAKYLEGTHDFTSF-KT 159
154249373 161 GEENTKTIRTINNLRIIEIKNGLILIRVEGISFLRGMVRSIVANLVRVGTGIWEPEKVKEVLESKDRSKSAGLAPAHGLF 240
217077259 159 GKDEKNPVRTIYRIRILTLKKGLILIRVEGRSFLRSMVRNIVGSLVRVGLGQWKPEKILEVLEKRSRQEAAGTAPPHGLY 238
170289026 160 GSDERDPVRTIYRIRILRLKNDLVLIRVEGRSFLRRMVRNIVAALVKVGLKQWEPEKMKEVLEARDRSAAAGTAPAHGLY 239
160903290 160 GNDERNPIRTIYRVRIIELRKDLILIRVEGKSFLKRMVRNIVGSLVKVGTDVWEVEKIQEILEAKKRALAPASAPAQGLY 239
222100131 160 GSDERDPVRTIYRIRILSLGKDMILIRVEGRSFLRRMVRNIVAALVKVGLRQWEPEKLKEVLEARDRSAAAGTAPAHGLY 239
157363557 160 GDHRENTVRTIYRVRVLQLRGGIILIRVEGRSFLRRMVRNMVGALVKVGVGEWKPEDISRVLELKDRSKAAVTAPPHGLY 239
150020829 159 GNDKKNPIRTVYRIRILNVKKELILIRVEGRSFLRSMVRNIVGSLVRVGLGQWTPEKIKKVLEARSRQEAAGTAPPHGLY 238
148270348 160 GSDERDPVRTIYRIRILRLKNDLVLIRVEGRSFLRRMVRNIVAALVKVGLKQWEPEKMKEVLEARDRSAAAGTAPAHGLY 239
15644322  160 GSDERDPVRTIYRIRILRLKNDLVLIRVEGRSFLRRMVRNIVAALVKVGLKQWEPEKMKEVLEARDRSAAAGTAPAHGLY 239
239618279 160 GHDDRSTIRTITGIRILRLQKNIILIRVEGISFLRRMVRNIVGLLMRVGTGGIEPKKTKEILEARDRSKLPSSAPAHGLV 239
281412654 160 GSDERDPVRTIYRIRILRLKNDLVLIRVEGRSFLRRMVRNIVAALVKVGLKQWEPEKMKEVLEARDRSAAAGTAPAHGLY 239
154249373 241 LYKVLF 246
217077259 239 LYKVLF 244
170289026 240 FYKVLF 245
160903290 240 FYSALF 245
222100131 240 FYKVLF 245
157363557 240 LYAVDF 245
150020829 239 LYKVLF 244
148270348 240 FYKVLF 245
15644322  240 FYKVLF 245
239618279 240 LHKVIF 245
281412654 240 FYKVLF 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap