Conserved Protein Domain Family
pgaD

?
PRK14585: pgaD 
putative PGA biosynthesis protein; Provisional
Statistics
?
PSSM-Id: 173049
View PSSM: PRK14585
Aligned: 24 rows
Threshold Bit Score: 235.26
Threshold Setting Gi: 110641204
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
238900279   1 MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFQ 80 
26247045    1 MNNLIITTRQSPVRLMVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFQ 80 
110641204   1 MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAIDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFK 80 
91210113    1 MNNLIITTRQSPVRLMVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFQ 80 
117623216   1 MNNLIITTRQSPVRLMVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFQ 80 
218557910   1 MNNLIITTRQSPVRLMVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFQ 80 
218700469   1 MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAIDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFK 80 
254792279   1 MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFQ 80 
254161133   1 MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFQ 80 
260843266   1 MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLLAVANAVVLIVWALYNKLRFQ 80 
238900279  81 KQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKALVRA 137
26247045   81 KQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKALVRA 137
110641204  81 KQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKTLVRV 137
91210113   81 KQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKALVRA 137
117623216  81 KQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKALVRA 137
218557910  81 KQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKALVRA 137
218700469  81 KQQHHAAYQYTPREYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKTLVRV 137
254792279  81 KQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKALVRA 137
254161133  81 KQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKALVRA 137
260843266  81 KQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFTSQGQIKMVVSEKALVRA 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap