Conserved Protein Domain Family
PRK14578

?
PRK14578: PRK14578 
elongation factor P; Provisional
Statistics
?
PSSM-Id: 173042
View PSSM: PRK14578
Aligned: 9 rows
Threshold Bit Score: 341.431
Threshold Setting Gi: 77918165
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222054353   1 MFTTSDFKKGLVIQLDGAPCILVDVTFQSPSARGANTMVKTKYRNLITAQVLEKTFRSGDKVDEADFERHKGQFLYADGD 80 
189423753   1 MYTTSDFKKGLVIQLEGAPCLLLDVTIQSPSARGANTMVKTRYRNLLTGQVLDRTFRSGDKVEEADYERHKGQFLYADGE 80 
197116813   1 MYTTNDFKKGLVIQLDGAPCVLVDVSFQSPSARGANTMVKTKYRNLITSQVLEKTFRSGDKVDEADFERHKGQFLYADGG 80 
148262424   1 MYTTSDFKRGLVIQLDGAPCILVDVTFQSPTARGSNTMVKTKYRNLITAQVLEKTFRSGDKVDEADFERHKGQFLYTDGD 80 
118581703   1 MYSTSDFKKGLVIQLDGAPCLIVDVTVQSPTARGANTMVKTKYRNLITSQVLEKTFRSGDKVDEADFERHKGQFLYADGG 80 
78221326    1 MLTTSDFKRGLVIKLDGAPCVILDVHFQSPSARGASTMVKTKYRNLLTAQVLEKTFRSGDKVEEADFERHKGQFLYADGD 80 
77918165    1 MATTADLKRNLVIQIDNAPCLVLDVNTQTPSARGGSTLIKTKYRNLLTGQVLEKAFKGGERIEDADFERRKGQFLYAIDE 80 
39995573    1 MLTTSDFKRGLVIKLDNSPCLILDVHFQSPSARGASTMVKTRYRNLLTGQVLDKTFRSGDKVEEADFERHKGQYLYADGD 80 
253699065   1 MYTTNDFKKGLVIQLDGAPCVLVDVSFQSPSARGANTMVKTKYRNLITSQVLEKTFRSGDKVDEADFERHKGQFLYADGG 80 
222054353  81 KGIFMDLETYEQFELEADAFEAIAHFLLEGTEVQLGLFEGRMVNVDLPMTVELTVTDTAPVLKNATATAQTKEAVLETGF 160
189423753  81 CGVFMDLETYEQFEMDEEAFSAISLFLLEGTEVTLGLFQGRMVMAEPPMVVELTVTDTAPIIKHATATAETKDAILETGL 160
197116813  81 RGVFMDLETYEQFEMEEDNFSAIAPFLLDGTEVQLGIFQERMVNVDLPMTVELVVTETAPAMKNATATAQTKEAVLETGL 160
148262424  81 KGVFMDLETYEQFELESDGFEPIAPFLLEGTEVQLGLFQGRMVNVDLPMTVELTVTDTAPVLKNATATAQTKEAILETGH 160
118581703  81 RGVFMDLENYEQFEVEQDEFAPLSPYLLEGTEVVLGLFEARLVNVELPMTVELTVAETVPVMKNATATAQTKEAMLETGL 160
78221326   81 RGVFMDLETYEQFEMDADSFSAIQPYLLDGTEVTLGLFQERLVSVDPPQVVELTVTDTPPIMKNATATAQTKEATLETGL 160
77918165   81 QGVFMDLESYDQYELGGDMYEDIRGYLVDGMELQMGVFQGQVVSIDLPQTVELTVVETAPALKNATATAQTKEAVLETGL 160
39995573   81 RGVFMDMETYEQFEMDAESFQVIQPYLLDGTEVVLGLFQERLVSVDPPQVVELTITDTPPVIKNATATAQTKEATLETGL 160
253699065  81 RGIFMDLETYEQFEMEEDNFSAIAPFLLDGTEVQLGIFQERMVNVDLPMTVELVVTETAPAMKNATATAQTKEAVLETGL 160
222054353 161 RIQVPPYLNSGEKIKVDTRDGRFISRA 187
189423753 161 KLKVPPYLENGVKIKVDTRDGRFLSRA 187
197116813 161 RLQVPPYLEAGEKIKVDTRDGRFISRA 187
148262424 161 KLQVPPYLNSGEKIKVDTRDGKFISRA 187
118581703 161 KLQVPPYLEVGERIKVDTRDGRFISRA 187
78221326  161 TLQVPPYLEVGEKIKVDTRDCRFVSRA 187
77918165  161 RLQVPPYLESGERIKVDTRECRFISRA 187
39995573  161 TLQVPPYLEVGEKIKVDTRDCRFISRA 187
253699065 161 RLQVPPYLESGEKVKVDTRDGRFISRA 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap