Conserved Protein Domain Family
PRK14576

?
PRK14576: PRK14576 
putative endopeptidase; Provisional
Links
?
Statistics
?
PSSM-Id: 173040
View PSSM: PRK14576
Aligned: 11 rows
Threshold Bit Score: 793.064
Threshold Setting Gi: 162421091
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
170024471   1 MGKEKIEHLEAVSRKARVVMEREGIDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDANIPSQIIMNEFEAAST 80 
162421091   1 MGKEKIEHLEAVSRKARVVMEREGIDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDANIPSQIIMNEFEAAST 80 
186895309   1 MGKEKIEHLEAVSRKARVVMEREGIDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDANIPSQIIMNEFEAAST 80 
218929064   1 MGKEKIEHLEAVSRKARVVMEREGIDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDANIPSQIIMNEFEAAST 80 
153950594   1 MGKEKIEHLEAVSRKARVVMEREGIDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDANIPSQIIMNEFEAAST 80 
145598467   1 MGKEKIEHLEAVSRKARVVMEREGIDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDANIPSQIIMNEFEAAST 80 
123442715   1 MNKEKIAHLNAVSRKARTVMEREGLDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDESIPSQIIMNEFEAAST 80 
108807329   1 MGKEKIEHLEAVSRKARVVMEREGIDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDANIPSQIIMNEFEAAST 80 
51596274    1 MGKEKIEHLEAVSRKARVVMEREGIDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDANIPSQIIMNEFEAAST 80 
45441508    1 MGKEKIEHLEAVSRKARVVMEREGIDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDANIPSQIIMNEFEAAST 80 
22126244    1 MGKEKIEHLEAVSRKARVVMEREGIDALVVTVCDNFYYLTGFASFFMYTFRHTGAAVAIMFRDANIPSQIIMNEFEAAST 80 
170024471  81 HFDMPNSVLKTFPVWVDVDDPRNPHHHYKKRDRPIGPPVEAVFSLVKNALEDAGVLDKTIAIELQAMSNGGKGVLDKVAP 160
162421091  81 HFDMPNSVLKTFPVWVDVDDPRNPHHHYKKRDRPIGPPVEAVFSLVKNALEDAGVLDKTIAIELQAMSNGGKGVLDKVAP 160
186895309  81 HFDMPNSVLKTFPVWVDVDDPRNPHHHYKKRDRPIGPPVEAVFSLVKNALEDAGVLDKTIAIELQAMSNGGKGVLDKVAP 160
218929064  81 HFDMPNSVLKTFPVWVDVDDPRNPHHHYKKRDRPIGPPVEAVFSLVKNALEDAGVLDKTIAIELQAMSNGGKGVLDKVAP 160
153950594  81 HFDMPNSVLKTFPVWVDVDDPRNPHHHYKKRDRPIGPPVEAVFSLVKNALEDAGVLDKTIAIELQAMSNGGKGVLDKVAP 160
145598467  81 HFDMPNSVLKTFPVWVDVDDPRNPHHHYKKRDRPIGPPVEAVFSLVKNALEDAGVLDKTIAIELQAMSNGGKGVLDKVAP 160
123442715  81 HFDMPNMELKTFPVWVDVDDPRNPLNHQKKPERPIGPPIEAVFGLVKDALERAEVLDKAIAIELQAMSNGGKSVLDKVAP 160
108807329  81 HFDMPNSVLKTFPVWVDVDDPRNPHHHYKKRDRPIGPPVEAVFSLVKNALEDAGVLDKTIAIELQAMSNGGKGVLDKVAP 160
51596274   81 HFDMPNSVLKTFPVWVDVDDPRNPHHHYKKRDRPIGPPVEAVFSLVKNALEDAGVLDKTIAIELQAMSNGGKGVLDKVAP 160
45441508   81 HFDMPNSVLKTFPVWVDVDDPRNPHHHYKKRDRPIGPPVEAVFSLVKNALEDAGVLDKTIAIELQAMSNGGKGVLDKVAP 160
22126244   81 HFDMPNSVLKTFPVWVDVDDPRNPHHHYKKRDRPIGPPVEAVFSLVKNALEDAGVLDKTIAIELQAMSNGGKGVLDKVAP 160
170024471 161 GLKLVDSTALFNEIRMIKSPWEIEHLRKSAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSRFNLISVGDN 240
162421091 161 GLKLVDSTALFNEIRMIKSPWEIEHLRKRAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSRFNLISVGDN 240
186895309 161 GLKLVDSTALFNEIRMIKSPWEIEHLRKSAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSRFNLISVGDN 240
218929064 161 GLKLVDSTALFNEIRMIKSPWEIEHLRKSAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSRFNLISVGDN 240
153950594 161 GLKLVDSTALFNEIRMIKSPWEIEHLRKSAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSRFNLISVGDN 240
145598467 161 GLKLVDSTALFNEIRMIKSPWEIEHLRKSAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSRFNLISVGDN 240
123442715 161 GLKLVDSTALFNEIRMIKSPWEIQHLRKSAEITEFGIASAAKHIRVGCTAAELTAAFKAAVMTFPETNFSRFNLISVGDN 240
108807329 161 GLKLVDSTALFNEIRMIKSPWEIEHLRKSAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSRFNLISVGDN 240
51596274  161 GLKLVDSTALFNEIRMIKSPWEIEHLRKSAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSRFNLISVGDN 240
45441508  161 GLKLVDSTALFNEIRMIKSPWEIEHLRKSAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSRFNLISVGDN 240
22126244  161 GLKLVDSTALFNEIRMIKSPWEIEHLRKSAEITEYGIASAAKKIRVGCTAAELTAAFKAAVMSFPETNFSRFNLISVGDN 240
170024471 241 FSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEPDKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAV 320
162421091 241 FSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEPDKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAV 320
186895309 241 FSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEPDKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAV 320
218929064 241 FSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEPDKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAV 320
153950594 241 FSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEPDKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAV 320
145598467 241 FSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEPDKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAV 320
123442715 241 FSPKMFPDETPAKPGDLIKFDCGVDVAGYGADLARTFVLGEPDELTQQIYNTIRIGHEHMLSMVAPGVKLKDVFDSTMDV 320
108807329 241 FSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEPDKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAV 320
51596274  241 FSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEPDKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAV 320
45441508  241 FSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEPDKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAV 320
22126244  241 FSPKIIADTTPAKVGDLIKFDCGIDVAGYGADLARTFVLGEPDKLTQQIYDTIRTGHEHMLSMVAPGVKLKAVFDSTMAV 320
170024471 321 IKTSGLPHYNRGHLGHGDGVFLGLEEAPFVSTQATETFCPGMVLSLETPYYGIGVGSIMLEDMILITDSGFEFLSKLDRD 400
162421091 321 IKTSGLPHYNRGHLGHGDGVFLGLEEVPFVSTQATETFCPGMVLSLETPYYGIGVGSIMLEDMILITDSGFEFLSKLDRD 400
186895309 321 IKTSGLPHYNRGHLGHGDGVFLGLEEAPFVSTQATETFCPGMVLSLETPYYGIGVGSIMLEDMILITDSGFEFLSKLDRD 400
218929064 321 IKTSGLPHYNRGHLGHGDGVFLGLEEVPFVSTQATETFCPGMVLSLETPYYGIGVGSIMLEDMILITDSGFEFLSKLDRD 400
153950594 321 IKTSGLPHYNRGHLGHGDGVFLGLEEAPFVSTQATETFCPGMVLSLETPYYGIGVGSIMLEDMILITDSGFEFLSKLDRD 400
145598467 321 IKTSGLPHYNRGHLGHGDGVFLGLEEVPFVSTQATETFCPGMVLSLETPYYGIGVGSIMLEDMILITDSGFEFLSKLDRD 400
123442715 321 IKKAGLPHYHRGHLGHGDGVFLGLEEAPFVSTLATETFRPGMVLSLETPYYGIGIGSIMLEDMILITNDGYEFLSKLDRD 400
108807329 321 IKTSGLPHYNRGHLGHGDGVFLGLEEVPFVSTQATETFCPGMVLSLETPYYGIGVGSIMLEDMILITDSGFEFLSKLDRD 400
51596274  321 IKTSGLPHYNRGHLGHGDGVFLGLEEAPFVSTQATETFCPGMVLSLETPYYGIGVGSIMLEDMILITDSGFEFLSKLDRD 400
45441508  321 IKTSGLPHYNRGHLGHGDGVFLGLEEVPFVSTQATETFCPGMVLSLETPYYGIGVGSIMLEDMILITDSGFEFLSKLDRD 400
22126244  321 IKTSGLPHYNRGHLGHGDGVFLGLEEVPFVSTQATETFCPGMVLSLETPYYGIGVGSIMLEDMILITDSGFEFLSKLDRD 400
170024471 401 LRRYF 405
162421091 401 LRRYF 405
186895309 401 LRRYF 405
218929064 401 LRRYF 405
153950594 401 LRRYF 405
145598467 401 LRRYF 405
123442715 401 LRQYN 405
108807329 401 LRRYF 405
51596274  401 LRRYF 405
45441508  401 LRRYF 405
22126244  401 LRRYF 405
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap