Conserved Protein Domain Family
PRK14575

?
PRK14575: PRK14575 
putative peptidase; Provisional
Statistics
?
PSSM-Id: 173039
View PSSM: PRK14575
Aligned: 4 rows
Threshold Bit Score: 853.231
Threshold Setting Gi: 51597044
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51597044    1 MNSEKKEHLNTVSRKLRTIMERDNIDAVIVTTCDNFYHVTGILSFFMYTFRNTGTAIAVVFRDVKIPSLIIMNEFEAASL 80 
153949346   1 MNSEKKEHLNTVSRKLRTIMERDNIDAVIVTTCDNFYHVTGILSFFMYTFRNTGTAIAVVFRDVKIPSLIIMNEFEAASL 80 
186896127   1 MNSEKKEHLNTVSRKLRTIMERDNIDAVIVTTCDNFYHVTGILSFFMYTFRNTGTAIAVVFRDVKIPSLIIMNEFEAASL 80 
170023660   1 MNSEKKEHLNTVSRKLRTIMERDNIDAVIVTTCDNFYHVTGILSFFMYTFRNTGTAIAVVFRDVKIPSLIIMNEFEAASL 80 
51597044   81 TLDMPNAELKTFPVWVDVDDPFNMRDSANNNKERPIGPPIESVCNILKDALNDARVLNKKIAIDLNIMSNGGKRVIDAVM 160
153949346  81 TLDMPNAELKTFPVWVDVDDPFNMRDSANNNKERPIGPPIESVCNILKDALNDARVLNKKIAIDLNIMSNGGKRVIDAVM 160
186896127  81 TLDMPNAELKTFPVWVDVDDPFNMRDSANNNKERPIGPPIESVCNILKDALNDARVLNKKIAIDLNIMSNGGKRVIDAVM 160
170023660  81 TLDMPNAELKTFPVWVDVDDPFNMRDSANNNKERPIGPPIESVCNILKDALNDARVLNKKIAIDLNIMSNGGKRVIDAVM 160
51597044  161 PNVDFVDSSSIFNELRVIKSPWEIKRLRKSAEITEYGITEASKLIRVGCTSAELTAAYKAAVMSKSETHFSRFHLISVGA 240
153949346 161 PNVDFVDSSSIFNELRVIKSPWEIKRLRKSAEITEYGITEASKLIRVGCTSAELTAAYKAAVMSKSETHFSRFHLISVGA 240
186896127 161 PNVDFVDSSSIFNELRVIKSPWEIKRLRKSAEITEYGITEASKLIRVGCTSAELTAAYKAAVMSKSETHFSRFHLISVGA 240
170023660 161 PNVDFVDSSSIFNELRVIKSPWEIKRLRKSAEITEYGITEASKLIRVGCTSAELTAAYKAAVMSKSETHFSRFHLISVGA 240
51597044  241 DFSPKLIPSNTKACSGDLIKFDCGVDVDGYGADIARTFVVGEPPEITRKIYQTIRTGHEHMLSMVAPGVKMKDVFDSTME 320
153949346 241 DFSPKLIPSNTKACSGDLIKFDCGVDVDGYGADIARTFVVGEPPEITRKIYQTIRTGHEHMLSMVAPGVKMKDVFDSTME 320
186896127 241 DFSPKLIPSNTKACSGDLIKFDCGVDVDGYGADIARTFVVGEPPEITRKIYQTIRTGHEHMLSMVAPGVKMKDVFDSTME 320
170023660 241 DFSPKLIPSNTKACSGDLIKFDCGVDVDGYGADIARTFVVGEPPEITRKIYQTIRTGHEHMLSMVAPGVKMKDVFDSTME 320
51597044  321 VIKKSGLPNYNRGHLGHGNGVFLGLEESPFVSTHATESFTSGMVLSLETPYYGYNLGSIMIEDMILINKEGIEFLSKLPR 400
153949346 321 VIKKSGLPNYNRGHLGHGNGVFLGLEESPFVSTHATESFTSGMVLSLETPYYGYNLGSIMIEDMILINKEGIEFLSKLPR 400
186896127 321 VIKKSGLPNYNRGHLGHGNGVFLGLEESPFVSTHATESFTSGMVLSLETPYYGYNLGSIMIEDMILINKEGIEFLSKLPR 400
170023660 321 VIKKSGLPNYNRGHLGHGNGVFLGLEESPFVSTHATESFTSGMVLSLETPYYGYNLGSIMIEDMILINKEGIEFLSKLPR 400
51597044  401 DLVSFN 406
153949346 401 DLVSFN 406
186896127 401 DLVSFN 406
170023660 401 DLVSFN 406
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap