Conserved Protein Domain Family
hmsH

?
PRK14574: hmsH 
poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA
Links
?
Statistics
?
PSSM-Id: 173038
View PSSM: PRK14574
Aligned: 11 rows
Threshold Bit Score: 1585.12
Threshold Setting Gi: 123442714
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
170024470   1 MYNAFTTLLRPLHWHRMTLLALFISGFVVNPAMADTQYDSLIIRARAGDTAPVLDYLQEESKAGPLQSGQVDDWLQIAGW 80 
229220781   1 MYNAFTTLLRPLHWHRMTLLALFISGFVVNPAMADTQYDSLIIRARAGDTAPVLDYLQEESKAGPLQSGQVDDWLQIAGW 80 
229013128   1 MYNAFTTLLRPLHWHRMTLLALFISGFVVNPAMADTQYDSLIIRARAGDTAPVLDYLQEESKAGPLQSGQVDDWLQIAGW 80 
162421638   1 MYNAFTTLLRPLHWHRMTLLALFISGFVVNPAMADTQYDSLIIRARAGDTAPVLDYLQEESKAGPLQSGQVDDWLQIAGW 80 
186895310   1 MYNAFTTLLRPLHWHRMTLLALFISGFVVNPAMADTQYDSLIIRARAGDTAPVLDYLQEESKAGPLQSGQVDDWLQIAGW 80 
218929065   1 MYNAFTTLLRPLHWHRMTLLALFISGFVVNPAMADTQYDSLIIRARAGDTAPVLDYLQEESKAGPLQSGQVDDWLQIAGW 80 
108807330   1 MYNAFTTLLRPLHWHRMTLLALFISGFVVNPAMADTQYDSLIIRARAGDTAPVLDYLQEESKAGPLQSGQVDDWLQIAGW 80 
153950032   1 MYNAFTTLLRPLHWHRMTLLALFISGFVVNPAMADTQYDSLIIRARAGDTAPVLDYLQEESKAGPLQSGQVDDWLQIAGW 80 
123442714   1 MYNAFTTLLRPLHRHRITLLALLISGLSVNPALAETQYDSLIIKARAGDTAPVLDYLQKESKAGPLNSGQVDDWLQIAGW 80 
145598466   1 MYNAFTTLLRPLHWHRMTLLALFISGFVVNPAMADTQYDSLIIRARAGDTAPVLDYLQEESKAGPLQSGQVDDWLQIAGW 80 
51596275    1 MYNAFTTLLRPLHWHRMTLLALFISGFVVNPAMADTQYDSLIIRARAGDTAPVLDYLQEESKAGPLQSGQVDDWLQIAGW 80 
170024470  81 AGRDQEVIDVYERYQSSMNISSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLISGMIMTQADAGRGGVVLKQAT 160
229220781  81 AGRDQEVIDVYERYQSSMNISSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLISGMIMTQADAGRGGVVLKQAT 160
229013128  81 AGRDQEVIDVYERYQSSMNISSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLISGMIMTQADAGRGGVVLKQAT 160
162421638  81 AGRDQEVIDVYERYQSSMNISSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLISGMIMTQADAGRGGVVLKQAT 160
186895310  81 AGRDQEVIDVYERYQSSMNISSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLISGMIMTQADAGRGGVVLKQAT 160
218929065  81 AGRDQEVIDVYERYQSSMNISSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLISGMIMTQADAGRGGVVLKQAT 160
108807330  81 AGRDQEVIDVYERYQSSMNISSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLISGMIMTQADAGRGGVVLKQAT 160
153950032  81 AGRDQEVIDVYERYQSSMNISSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLISGMIMTQADAGRGGVVLKQAT 160
123442714  81 AGRDQEVIDVYERYHSSVNLSSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLITGMIMTQADSGRGGAALQQAK 160
145598466  81 AGRDQEVIDVYERYQSSMNISSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLISGMIMTQADAGRGGVVLKQAT 160
51596275   81 AGRDQEVIDVYERYQSSMNISSRGLASAARAYRNEKRWDQALALWQSSLKKDPTNPDLISGMIMTQADAGRGGVVLKQAT 160
170024470 161 ELAERDPTVQNYMTLSYLNRATDRNYDALQASSEAVRLAPTSEEVLKNHLEILQRNRIVEPALRLAKENPNLVSAEHYRQ 240
229220781 161 ELAERDPTVQNYMTLSYLNRATDRNYDALQASSEAVRLAPTSEEVLKNHLEILQRNRIVEPALRLAKENPNLVSAEHYRQ 240
229013128 161 ELAERDPTVQNYMTLSYLNRATDRNYDALQASSEAVRLAPTSEEVLKNHLEILQRNRIVEPALRLAKENPNLVSAEHYRQ 240
162421638 161 ELAERDPTVQNYMTLSYLNRATDRNYDALQASSEAVRLAPTSEEVLKNHLEILQRNRIVEPALRLAKENPNLVSAEHYRQ 240
186895310 161 ELAERDPTVQNYMTLSYLNRATDRNYDALQASSEAVRLAPTSEDVLKNHLEILQRNRIVEPALRLAKENPNLVSAEHYRQ 240
218929065 161 ELAERDPTVQNYMTLSYLNRATDRNYDALQASSEAVRLAPTSEEVLKNHLEILQRNRIVEPALRLAKENPNLVSAEHYRQ 240
108807330 161 ELAERDPTVQNYMTLSYLNRATDRNYDALQASSEAVRLAPTSEEVLKNHLEILQRNRIVEPALRLAKENPNLVSAEHYRQ 240
153950032 161 ELAERDPTVQNYMTLSYLNRATDRNYDALQASSEAVRLAPTSEEVLKNHLEILQRNRIVEPALRLAKENPNLVSAEHYRQ 240
123442714 161 ELAERNPSAQNYMTLSYLNRATNRNYDALQASSEAVRLAPESEEVLKNHLEILQRNRIADPALQLARENPQLVTAEQYRQ 240
145598466 161 ELAERDPTVQNYMTLSYLNRATDRNYDALQASSEAVRLAPTSEEVLKNHLEILQRNRIVEPALRLAKENPNLVSAEHYRQ 240
51596275  161 ELAERDPTVQNYMTLSYLNRATDRNYDALQASSEAVRLAPTSEDVLKNHLEILQRNRIVEPALRLAKENPNLVSAEHYRQ 240
170024470 241 LERDAAAEQVRMAVLPTRSETERFDIADKALADYQNLLTRWGKDPEAQADYQRARIDRLGALLVRHQTADLIKEYEAMEA 320
229220781 241 LERDAAAEQVRMAVLPTRSETERFDIADKALADYQNLLTRWGKDPEAQADYQRARIDRLGALLVRHQTADLIKEYEAMEA 320
229013128 241 LERDAAAEQVRMAVLPTRSETERFDIADKALADYQNLLTRWGKDPEAQADYQRARIDRLGALLVRHQTADLIKEYEAMEA 320
162421638 241 LERDAAAEQVRMAVLPTRSETERFDIADKALADYQNLLTRWGKDPEAQADYQRARIDRLGALLVRHQTADLIKEYEAMEA 320
186895310 241 LERDAAAEQVRMAVLPTRSETERFDIADKALADYQNLLTRWGKDPEAQADYQRARIDRLGALLVRHQTADLIKEYEAMEA 320
218929065 241 LERDAAAEQVRMAVLPTRSETERFDIADKALADYQNLLTRWGKDPEAQADYQRARIDRLGALLVRHQTADLIKEYEAMEA 320
108807330 241 LERDAAAEQVRMAVLPTRSETERFDIADKALADYQNLLTRWGKDPEAQADYQRARIDRLGALLVRHQTADLIKEYEAMEA 320
153950032 241 LERDAAAEQVRMAVLPTRSETERFDIADKALADYQNLLTRWGKDPEAQADYQRARIDRLGALLVRHQTADLIKEYEAMEA 320
123442714 241 LERDAAAEQVRMAVLPTRGETERFYIADQALADYQDLLARWSKDPDAQADYQRARIDRLGALLVRRNTAELIKEYESMEA 320
145598466 241 LERDAAAEQVRMAVLPTRSETERFDIADKALADYQNLLTRWGKDPEAQADYQRARIDRLGALLVRHQTADLIKEYEAMEA 320
51596275  241 LERDAAAEQVRMAVLPTRSETERFDIADKALADYQNLLTRWGKDPEAQADYQRARIDRLGALLVRHQTADLIKEYEAMEA 320
170024470 321 EGYKMPDYARRWAASAYIDRRLPEKAAPILSSLYYSDGKTFRNSDDLLDADDLYYSLNESEQLDKAYQFAVNYSEQTPYQ 400
229220781 321 EGYKMPDYARRWAASAYIDRRLPEKAAPILSSLYYSDGKTFRNSDDLLDADDLYYSLNESEQLDKAYQFAVNYSEQTPYQ 400
229013128 321 EGYKMPDYARRWAASAYIDRRLPEKAAPILSSLYYSDGKTFRNSDDLLDADDLYYSLNESEQLDKAYQFAVNYSEQTPYQ 400
162421638 321 EGYKMPDYARRWAASAYIDRRLPEKAAPILSSLYYSDGKTFRNSDDLLDADDLYYSLNESEQLDKAYQFAVNYSEQTPYQ 400
186895310 321 EGYKMPDYARRWAASAYIDRRLPEKAAPILSSLYYSDGKTFRNSDDLLDADDLYYSLNESEQLDKAYQFAVNYSEQTPYQ 400
218929065 321 EGYKMPDYARRWAASAYIDRRLPEKAAPILSSLYYSDGKTFRNSDDLLDADDLYYSLNESEQLDKAYQFAVNYSEQTPYQ 400
108807330 321 EGYKMPDYARRWAASAYIDRRLPEKAAPILSSLYYSDGKTFRNSDDLLDADDLYYSLNESEQLDKAYQFAVNYSEQTPYQ 400
153950032 321 EGYKMPDYARRWAASAYIDRRLPEKAAPILSSLYYSDGKTFRNSDDLLDADDLYYSLNESEQLDKAYQFAVNYSEQTPYQ 400
123442714 321 EGYKMPDYARRWAASAYIDRRMPEKAAPILTSLYYADGKTFRNSDDLLDADDLYYALNESEQLDKAHQFAKSYSEQTPYQ 400
145598466 321 EGYKMPDYARRWAASAYIDRRLPEKAAPILSSLYYSDGKTFRNSDDLLDADDLYYSLNESEQLDKAYQFAVNYSEQTPYQ 400
51596275  321 EGYKMPDYARRWAASAYIDRRLPEKAAPILSSLYYSDGKTFRNSDDLLDADDLYYSLNESEQLDKAYQFAVNYSEQTPYQ 400
170024470 401 VGVYGLPGKEPNDDWIEGQTLLVQSLVALNDLPTAQKKLEDLSSTAPANQNLRIALASIYLARDLPRKAEQELKAVESLA 480
229220781 401 VGVYGLPGKEPNDDWIEGQTLLVQSLVALNDLPTAQKKLEDLSSTAPANQNLRIALASIYLARDLPRKAEQELKAVESLA 480
229013128 401 VGVYGLPGKEPNDDWIEGQTLLVQSLVALNDLPTAQKKLEDLSSTAPANQNLRIALASIYLARDLPRKAEQELKAVESLA 480
162421638 401 VGVYGLPGKEPNDDWIEGQTLLVQSLVALNDLPTAQKKLEDLSSTAPANQNLRIALASIYLARDLPRKAEQELKAVESLA 480
186895310 401 VGVYGLPGKEPNDDWIEGQTLLVQSLVALNDLPTAQKKLEDLSSTAPANQNLRIALASIYLARDLPRKAEQELKAVESLA 480
218929065 401 VGVYGLPGKEPNDDWIEGQTLLVQSLVALNDLPTAQKKLEDLSSTAPANQNLRIALASIYLARDLPRKAEQELKAVESLA 480
108807330 401 VGVYGLPGKEPNDDWIEGQTLLVQSLVALNDLPTAQKKLEDLSSTAPANQNLRIALASIYLARDLPRKAEQELKAVESLA 480
153950032 401 VGVYGLPGKEPNDDWIEGQTLLVQSLVALNDLPTAQKKLEDLSSTAPANQNLRIALASIYLARDLPRKAEQELKAVESLA 480
123442714 401 VGVYGLPGKEPNDDWMEGQTLLVQSLVALNDLPAAQKKLETLSSTAPANQNLRIALASVYLARDLPRKAEQELKAVESLA 480
145598466 401 VGVYGLPGKEPNDDWIEGQTLLVQSLVALNDLPTAQKKLEDLSSTAPANQNLRIALASIYLARDLPRKAEQELKAVESLA 480
51596275  401 VGVYGLPGKEPNDDWIEGQTLLVQSLVALNDLPTAQKKLEDLSSTAPANQNLRIALASIYLARDLPRKAEQELKAVESLA 480
170024470 481 PRSLILERAQAETAMALQEWHQMELLTDDVISRSPEDIPSQELDRQRKVHNMYELRVSGNRVISSNSPVSGNKDYGVETL 560
229220781 481 PRSLILERAQAETAMALQEWHQMELLTDDVISRSPEDIPSQELDRQRKVHNMYELRVSGNRVISSNSPVSGNKDYGVETL 560
229013128 481 PRSLILERAQAETAMALQEWHQMELLTDDVISRSPEDIPSQELDRQRKVHNMYELRVSGNRVISSNSPVSGNKDYGVETL 560
162421638 481 PRSLILERAQAETAMALQEWHQMELLTDDVISRSPEDIPSQELDRQRKVHNMYELRVSGNRVISSNSPVSGNKDYGVETL 560
186895310 481 PRSLILERAQAETAMALQEWHQMELLTDDVISRSPEDIPSQELDRQRKVHNMYELRVSGNRVISSNSPVSGNKDYGVETL 560
218929065 481 PRSLILERAQAETAMALQEWHQMELLTDDVISRSPEDIPSQELDRQRKVHNMYELRVSGNRVISSNSPVSGNKDYGVETL 560
108807330 481 PRSLILERAQAETAMALQEWHQMELLTDDVISRSPEDIPSQELDRQRKVHNMYELRVSGNRVISSNSPVSGNKDYGVETL 560
153950032 481 PRSLILERAQAETAMALQEWHQMALLTDDVISRSPEDIPSQELDRQRKVHNMYELRVSGNRVISSNSPVSGNKDYGVETL 560
123442714 481 PRSLILERAQAETAMDLQEWRQMELLTDDVIARSPEDVPSQELDRQRKVHNMYELRISSNRTLSSNSPVSGNKDYGVETL 560
145598466 481 PRSLILERAQAETAMALQEWHQMELLTDDVISRSPEDIPSQELDRQRKVHNMYELRVSGNRVISSNSPVSGNKDYGVETL 560
51596275  481 PRSLILERAQAETAMALQEWHQMELLTDDVISRSPEDIPSQELDRQRKVHNMYELRVSGNRVISSNSPVSGNKDYGVETL 560
170024470 561 LYSPPIAENWRVFGGGSYNNGQFEEGTGISRILRLGGEWTSRDHWVEGEISNQNYgnGNGNKVGARLSTWYDLNDHWRVG 640
229220781 561 LYSPPIAENWRVFGGGSYNNGQFEEGTGISRILRLGGEWTSRDHWVEGEISNQNY--GNGNKVGARLSTWYDLNDHWRVG 638
229013128 561 LYSPPIAENWRVFGGGSYNNGQFEEGTGISRILRLGGEWTSRDHWVEGEISNQNY--GNGNKVGARLSTWYDLNDHWRVG 638
162421638 561 LYSPPIAENWRVFGGGSYNNGQFEEGTGISRILRLGGEWTSRDHWVEGEISNQNY--GNGNKVGARLSTWYDLNDHWRVG 638
186895310 561 LYSPPIAENWRVFGGGSYNNGQFEEGTGISRILRLGGEWTSRDHWVEGEISNQNY--GNGNKVGARLSTWYDLNDHWRVG 638
218929065 561 LYSPPIAENWRVFGGGSYNNGQFEEGTGISRILRLGGEWTSRDHWVEGEISNQNY--GNGNKVGARLSTWYDLNDHWRVG 638
108807330 561 LYSPPIAENWRVFGGGSYNNGQFEEGTGISRILRLGGEWTSRDHWVEGEISNQNY--GNGNKVGARLSTWYDLNDHWRVG 638
153950032 561 LYSPPIAENWRVFGGGSYNNGQFEEGTGISRILRLGGEWTSRDHWVEGEISNQNY--GNGNKVGARLSTWYDLNDHWRVG 638
123442714 561 LYSPPIADNWRVFGGGDYNNAQFEEGKGINRIMRLGGEWTSRDVWAEAEVNNQNY--GFGNKTGFRLASWYDFNDHWRVG 638
145598466 561 LYSPPIAENWRVFGGGSYNNGQFEEGTGISRILRLGGEWTSRDHWVEGEISNQNY--GNGNKVGARLSTWYDLNDHWRVG 638
51596275  561 LYSPPIAENWRVFGGGSYNNGQFEEGTGISRILRLGGEWTSRDHWVEGEISNQNY--GNGNKVGARLSTWYDLNDHWRVG 638
170024470 641 GQVERLAKDTPLRALKNKVTANSASAYVFWKADDKRDAELSVTPSRFSDGNNRWEYEFNGRQRIWTGPYLTADFNLGLAA 720
229220781 639 GQVERLAKDTPLRALKNKVTTNSASAYVFWKADDKRDAELSVTPSRFSDGNNRWEYEFNGRQRIWTGPYLTADFNLGLAA 718
229013128 639 GQVERLAKDTPLRALKNKVTANSASAYVFWKADDKRDAELSVTPSRFSDGNNRWEYEFNGRQRIWTGPYLTADFNLGLAA 718
162421638 639 GQVERLAKDTPLRALKNKVTANSASAYVFWKADDKRDAELSVTPSRFSDGNNRWEYEFNGRQRIWTGPYLTADFNLGLAA 718
186895310 639 GQVERLAKDTPLRALKNKVTANSASAYVFWKADDKRDAELSVTPSRFSDGNNRWEYEFNGRQRIWTGPYLTADFNLGLAA 718
218929065 639 GQVERLAKDTPLRALKNKVTANSASAYVFWKADDKRDAELSVTPSRFSDGNNRWEYEFNGRQRIWTGPYLTADFNLGLAA 718
108807330 639 GQVERLAKDTPLRALKNKVTANSASAYVFWKADDKRDAELSVTPSRFSDGNNRWEYEFNGRQRIWTGPYLTADFNLGLAA 718
153950032 639 GQVERLAKDTPLRALKNKVTANSASAYVFWKADDKRDAELSVTPSRFSDGNNRWEYEFNGRQRIWTGPYLTADFNLGLAA 718
123442714 639 GQVERLAKDTPLRAMRNNITANSASAFVLWKGDDRRDVEFNVTPSDYSDGNKRWEYELNGRQRIWTGPYLTADFNLGLAA 718
145598466 639 GQVERLAKDTPLRALKNKVTANSASAYVFWKADDKRDAELSVTPSRFSDGNNRWEYEFNGRQRIWTGPYLTADFNLGLAA 718
51596275  639 GQVERLAKDTPLRALKNKVTANSASAYVFWKADDKRDAELSVTPSRFSDGNNRWEYEFNGRQRIWTGPYLTADFNLGLAA 718
170024470 721 SQNSKEDVIYYNPKRDFAYVPAVTLNHIMYRRYKTIWSQQVQLGVGGYWEKNYGNGLVTTAGYGQRVQWNDVIDTGVAVV 800
229220781 719 SQNSKEDVIYYNPKRDFAYVPAVTLNHIMYRRYKTIWSQQVQLGVGGYWEKNYGNGLVTTAGYGQRVQWNDVIDTGVAVV 798
229013128 719 SQNSKEDVIYYNPKRDFAYVPAVTLNHIMYRRYKTIWSQQVQLGVGGYWEKNYGNGLVTTAGYGQRVQWNDVIDTGVAVV 798
162421638 719 SQNSKEDVIYYNPKRDFAYVPAVTLNHIMYRRYKTIWSQQVQLGVGGYWEKNYGNGLVTTAGYGQRVQWNDVIDTGVAVV 798
186895310 719 SQNSKEDVIYYNPKRDFAYVPAVTLNHIMYRRYKTIWSQQVQLGVGGYWEKNYGNGLVTTAGYGQRVQWNDVIDTGVAVV 798
218929065 719 SQNSKEDVIYYNPKRDFAYVPAVTLNHIMYRRYKTIWSQQVQLGVGGYWEKNYGNGLVTTAGYGQRVQWNDVIDTGVAVV 798
108807330 719 SQNSKEDVIYYNPKRDFAYVPAVTLNHIMYRRYKTIWSQQVQLGVGGYWEKNYGNGLVTTAGYGQRVQWNDVIDTGVAVV 798
153950032 719 SQNSKEDVIYYNPKRDFAYVPAVTLNHIMYRRYKTIWSQQVQLGVGGYWEKNYGNGLVTTAGYGQRVQWNDVIDTGVAVV 798
123442714 719 STNTKEDVIYYNPKRDFTYLPAVTLNHIMYRHYKTIWSQQVQLGVGGYWEKNYGNGLVTTASYGQRVQWNDVVDTGLAVT 798
145598466 719 SQNSKEDVIYYNPKRDFAYVPAVTLNHIMYRRYKTIWSQQVQLGVGGYWEKNYGNGLVTTAGYGQRVQWNDVIDTGVAVV 798
51596275  719 SQNSKEDVIYYNPKRDFAYVPAVTLNHIMYRRYKTIWSQQVQLGVGGYWEKNYGNGLVTTAGYGQRVQWNDVIDTGVAVV 798
170024470 801 YDKRPYDGKREHDVTLSFDLNYRF 824
229220781 799 YDKRPYDGKREHDVTLSFDLNYRF 822
229013128 799 YDKRPYDGKREHDVTLSFDLNYRF 822
162421638 799 YDKRPYDGKREHDVTLSFDLNYRF 822
186895310 799 YDKRPYDGKREHDVTLSFDLNYRF 822
218929065 799 YDKRPYDGKREHDVTLSFDLNYRF 822
108807330 799 YDKRPYDGKREHDVTLSFDLNYRF 822
153950032 799 YDKRPYDGKREHDVTLSFDLNYRF 822
123442714 799 YDKRPYDGVREHDLSLAFDLNYRF 822
145598466 799 YDKRPYDGKREHDVTLSFDLNYRF 822
51596275  799 YDKRPYDGKREHDVTLSFDLNYRF 822
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap